KEGG   Streptomyces davaonensis: BN159_2505Help
Entry
BN159_2505        CDS       T02518                                 

Definition
(GenBank) actinorhodin polyketide synthase bifunctional cyclase/dehydratase
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv01056  Biosynthesis of type II polyketide backbone
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Module
sdv_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    BN159_2505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sdv01004]
    BN159_2505
   01008 Polyketide biosynthesis proteins [BR:sdv01008]
    BN159_2505
Enzymes [BR:sdv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     BN159_2505
Lipid biosynthesis proteins [BR:sdv01004]
 Polyketide synthase
  Component type
   BN159_2505
Polyketide biosynthesis proteins [BR:sdv01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     BN159_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc DUF2505
Motif
Other DBs
NCBI-ProteinID: CCK26884
UniProt: K4R2J6
LinkDB All DBs
Position
2822333..2823304
Genome map
AA seq 323 aa AA seqDB search
MSAPARTEVYEVEHRAEVAAPAELAYRLLSDVTHWPRLFPNIVHMEQFSSDGDGTSERVG
VWLTSGERVFPWVALRVLRPGELRVDYRQETTQAPVADMGGSWIVEPLSERACRVRLLHD
CRPATDEPATLEFIAETLERNSTAELAAFKEAAEREAADERLVTEIEDTARVDGSVADVY
EFLADAAAWPGRIPHIVSVDAREGGDNVQLLDWVTHTERGVDHPSKVVRVCFPPDRIVYR
HQLLPPLAAVHTGSYTVTADGDGAVVSSRHTVVLSESGIASVLGEGADVEQARDFTRRAL
STSSREVLARAKEFAEHRRHGGG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccggcgaggaccgaggtgtacgaggtggagcaccgcgccgaggtcgccgcc
ccggccgaactggcgtaccggctgctctccgacgtcacccattggccgcggctcttcccg
aacatcgtgcacatggagcagttctccagcgacggcgacggtacgagcgaacgtgtcggc
gtctggctgacctcgggcgagcgggtgttcccctgggtggcgctgcgcgtgctgcgcccc
ggggagctgcgggtcgactaccggcaggagacgacccaggcgccggtcgccgacatgggc
ggctcctggatcgtggagccgctctcggaacgggcgtgccgggtgcggctgctgcacgac
tgccggccggccacggacgagcccgccacgctggagttcatcgccgagaccctggagcgc
aacagtacggcggaactcgccgcgttcaaggaggcggccgagcgggaggccgccgacgag
cggctggtgaccgagatcgaggacacggcgcgggtcgacggatcggtcgcggacgtctac
gagttcctcgccgacgcggccgcctggcccgggcgcattccgcacatcgtgtcggtggac
gcccgcgagggcggcgacaacgtgcagctgctggactgggtcacccacaccgagcgcggc
gtggaccacccctccaaggtcgtccgggtgtgcttcccgccggaccggatcgtgtaccgg
catcagttgctgccgccgctggccgccgtgcacaccggcagctacaccgtgacggccgac
ggagacggggccgtggtgtcctcccggcacaccgtggtcctgtccgagtccggcatcgcg
agtgtgctgggcgagggggcggacgtggaacaggcccgtgacttcacccggcgggcgctg
agcaccagcagccgggaggtgctggcgcgggcgaaggagttcgccgagcaccgacggcac
gggggcgggtga

DBGET integrated database retrieval system