KEGG   Streptomyces davaonensis: BN159_3113Help
Entry
BN159_3113        CDS       T02518                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sdv  Streptomyces davaonensis
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN159_3113 (sodN)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN159_3113 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: CCK27492
UniProt: K4R2Y5
LinkDB All DBs
Position
3537348..3537743
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQDKMAANDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDALKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtgaaggtcagcgcgcactgcgacctgccctgc
ggtgtgtacgaccctgcccaggcccgcatcgaggcggagtcggtcaaggccgtgcaggac
aagatggccgccaacgacgacccgcacttccaggcccgtgcgaccgtcatcaaggagcag
cgcgccgagctcgccaagcaccacgtgtcggtcctgtggagcgactacttcaagcctccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacgccctcaaggccctctcg
gccgccaaggcgtccacggacccggcgaccggtcagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system