KEGG   Streptomyces davaonensis: BN159_3592Help
Entry
BN159_3592        CDS       T02518                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00020  Citrate cycle (TCA cycle)
sdv00270  Cysteine and methionine metabolism
sdv00620  Pyruvate metabolism
sdv00630  Glyoxylate and dicarboxylate metabolism
sdv00680  Methane metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
sdv01130  Biosynthesis of antibiotics
sdv01200  Carbon metabolism
Module
sdv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sdv_M00012  Glyoxylate cycle
sdv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN159_3592 (mdh)
   00620 Pyruvate metabolism
    BN159_3592 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    BN159_3592 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    BN159_3592 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN159_3592 (mdh)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BN159_3592 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CCK27971
UniProt: K4QV72
LinkDB All DBs
Position
complement(4051573..4052562)
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIEISDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQASAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATIAGKNAAEVVSDEKWLADDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTADGDWVSMGIPSDGSYGVPEGLISSFPVTTKDGKYEIVQGLE
INDFSRARIDASVAELAEERDAVRALGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctgctggagatcaccccggcgctgaaggccgccgagggcacggccatggagctggacgac
tgcgcgttcccgcttctccagggcatcgagatcagcgacgacccgaacgtcgccttcgac
ggcgccaatgtcgcgctgctcgtcggcgcccgcccccgcaccaagggcatggagcgcggt
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgccctgatc
gcccaggcgtccgccccggacgtaccggccgagcgcttcaccgcgatgacccgtctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggctccacggtcgccgacatcaag
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacc
atcgccggcaagaacgccgccgaggtcgtgagcgacgagaagtggctggccgacgacttc
atcccgaccgtcgccaagcgcggtgcggcgatcatcgaggcccgtggcgcctcctccgcc
gcctcggccgccaacgccgccatcgaccacgtccacacctgggtcaacggcaccgccgac
ggcgactgggtctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttccccgtcaccaccaaggacggcaagtacgagatcgtccagggcctggag
atcaacgacttctcccgcgcccggatcgatgcctccgtcgccgagctggcggaggagcgg
gacgcggtccgcgccctcggcctcatctga

DBGET integrated database retrieval system