KEGG   Streptomyces davaonensis: BN159_4210Help
Entry
BN159_4210        CDS       T02518                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00380  Tryptophan metabolism
sdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BN159_4210 (kynU)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BN159_4210 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 GDC-P Glyoxalase_3
Motif
Other DBs
NCBI-ProteinID: CCK28589
UniProt: K4R7A5
LinkDB All DBs
Position
complement(4710469..4711656)
Genome map
AA seq 395 aa AA seqDB search
MSELRVRAEKLDAADELAAKRAGFVLDEVVYLDGNSLGALPANVPDRVADVVRRQWGALR
IRSWEESGWWTAPERIGDRIAPLVGAAPGQVVVGDSTSVNVFKALVAAVRMAGEGRDEIV
VDATTFPTDGYIAQSAARMTGCELRPVDPSEVPSVLGDRTAAVLLNHVDYRTGRLHDLPS
LTAAVHAAGALVVWDLCHSAGALPVGLDEHEVDLAVGCTYKYLNGGPGSPAYLYVRADLQ
SRFDSPLPGWNSHVDPFGMRGDYEPATGALRGRVGTPDILSMLALEAALEVWDDVPIESV
RAKSLALTDFFLECVEEYVPGGRVESLTPVAHEERGSQVALRCDDAAAVMERLIERGVVG
DFRAPDVLRFGFTPLYVGFADVERAARTLGETLGG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctcagggtccgggcggagaagctcgacgccgcggacgaactcgccgccaag
cgggccgggttcgtcctcgacgaggtcgtctacctcgacggcaactcgctcggcgcgctc
ccggcgaacgtgccggaccgggtcgcggacgtggtccggcgccagtggggcgccctgcgc
atccggtcctgggaggagagcggctggtggaccgcccccgagcggatcggcgaccggatc
gctccgctggtcggggcggcgccgggtcaagtcgtggtcggcgactcgacaagtgtcaat
gttttcaaggcacttgtggccgcggtgcggatggcgggcgaggggcgtgacgagatcgtc
gtggacgcgacgaccttccccaccgacggctacatagcgcagtcggcggcccggatgacg
ggctgcgagctgcggccggtggacccgtccgaggtcccgtcggtcctgggtgaccggacg
gccgccgtcctgctcaaccacgtcgactaccgcaccggccgcctgcacgacctgccgtcc
ctgacggccgcggtgcacgcggcgggggcgctggtggtctgggacctgtgccacagcgcg
ggcgcgctgccggtcggcctggacgagcacgaggtcgatctggcggtcggctgcacgtac
aagtacctgaacgggggcccgggttcaccggcgtacctctacgtacgagcggatctccag
agccgcttcgactccccgctgccgggctggaactcccacgtggaccccttcggcatgcgc
ggcgactacgaaccggccacgggggccctgcgcggtcgcgtcggcaccccggacatcctc
tccatgctcgcgctggaggcggcgctcgaggtctgggacgacgtgccgatcgagtcggta
cgggcgaagtccctggcgctgacggacttcttcctggagtgcgtcgaggagtacgtcccc
ggcggccgggtggagtcgctgaccccggtggcccacgaggagcggggcagccaggtcgcg
ctgcgctgcgacgacgcggccgcggtgatggagcggctgatcgagcggggagtggtgggc
gacttccgggccccggacgtcctgcgcttcggcttcactccgctgtacgtcggattcgcg
gacgtggagagggcggcgcggacgctgggggagacgctcggcgggtga

DBGET integrated database retrieval system