KEGG   Streptomyces davaonensis: BN159_5146Help
Entry
BN159_5146        CDS       T02518                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00620  Pyruvate metabolism
sdv00680  Methane metabolism
sdv01100  Metabolic pathways
sdv01120  Microbial metabolism in diverse environments
sdv01200  Carbon metabolism
Module
sdv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN159_5146 (ppc)
  Energy metabolism
   00680 Methane metabolism
    BN159_5146 (ppc)
Enzymes [BR:sdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BN159_5146 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCK29525
UniProt: K4R8Y7
LinkDB All DBs
Position
5718577..5721318
Genome map
AA seq 913 aa AA seqDB search
MSSADDLTTSTTSTSSELRADIRRLGDLLGETLVRQEGPDLLDLVERVRRLTREDGEAAA
ELLRGTELDTAAKLVRAFSTYFHLANVTEQVHRGRELRAKRAAEGGLLARTADRLKDADP
EHLRATVRHLNVRPVFTAHPTEAARRSVLNKLRRIATLLETPVIEADRRRYDTRLAENID
LVWQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVKLPDDTRPLT
FGTWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYTGATQELL
DSLAADLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKTRLAKGIPHEDGRDYLGTS
ELLHDLTLIQTSLREHRGGLFADGRMNRTIRTLAAFGLQLATMDVREHADAHHHALGQLF
DRLGEESWRYTDMPRDYRAKLLAKELRSRRPLAPTPAPVDAAGEKTLGVFQTVKRALEVF
GPEVIESYIISMCQGADDVFAAAVLAREAGLVDLHAGWAKIGIVPLLETTDELKAADTIL
EDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRL
RLFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTV
AATLQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQL
ADLHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVL
DEMHEQWHFFRNFVSNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHELTVREVL
KVTGETELLDATPALRQTFSIRDAYLDPISYLQVALLKRQRDAAAAGEQADPLLSRALLL
TVNGVAAGLRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgacctgactacgagcaccacgtcgaccagcagtgagctgcgcgcc
gacatcaggcgcctgggtgatctcctcggcgagaccctcgtccggcaggagggtccagac
cttctcgacctggtcgagagggtgcgtcgactgacccgcgaggacggcgaggccgccgcc
gagctgctgcgcggcaccgagctcgacaccgcggcgaagctggtccgcgccttctccacc
tacttccacctcgccaacgtcaccgagcaggtgcaccgcggccgcgagctgcgcgccaag
cgggccgccgagggcggactgctcgcccgtacggccgaccggctgaaggacgccgacccc
gagcacctgcgcgccacggtgcggcacctcaacgtccgcccggtcttcaccgcccacccc
accgaggccgcgcgccggtcggtgctgaacaagctccggcgcatcgcgacgcttctggag
accccggtcatcgaggcggaccgccggcgctacgacacccgtctggcggagaacatcgac
ctcgtctggcagaccgacgagctgcgcgtggtccgtcccgagcccgccgacgaggcccgc
aacgccatctactacctggacgagctgcacgcgggcgccgtcggggacgtcctggaggac
ctcacggccgagctggagcgggtcggcgtgaagctcccggacgacacccgtccgctcacc
ttcggcacctggatcggcggcgaccgcgacggcaaccccaacgtcaccccgcaggtcacc
tgggacgtgctgatcctccagcacgagcacggcatcaacgacgccctggagatgatcgac
gagctgcgcggcttcctgtcgaactccatccgctacaccggcgccacccaggagctgctg
gactccctcgcggcggacctggagcgcctgccggagatcagcccccgctacaagcggctg
aacgccgaggagccgtaccggctcaaggccacctgcatccggcagaagctggagaacacc
aagacgcggctggccaagggcatcccgcacgaggacggccgggactacctcggcacctcg
gagctgctgcacgacctgacgctgatccagacctcgctgcgcgagcaccggggcgggctg
ttcgccgacggccggatgaaccgcaccatccgcacgctggccgccttcggcctccagctc
gccacgatggacgtccgcgagcacgccgacgcccaccaccacgccctcgggcagctcttc
gaccggctcggcgaggagtcctggcggtacacggacatgccgcgcgactaccgggccaag
ctgctcgccaaggagctcaggtcccgccgtcccctcgcgcccaccccggcgccggtggac
gcggccggggagaagacgctcggtgtcttccagacggtcaagcgggcgctggaggtgttc
gggcccgaggtgatcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttc
gcggccgcggtgctggcccgcgaggccggtctggtcgatctgcacgcgggctgggcgaag
atcggcatcgtgccgctgctggagacgacggacgagctcaaggccgccgacacgatcctg
gaggacatgctctcggacccctcctaccggcggctcgtcgccctgcgcggcgatgtccag
gaggtcatgctcggctactccgactcctccaagttcggcggcatcaccacctcgcagtgg
gagatccaccgcgcccagcgccggctgcgcgacgtggcccaccgctacggcgtacggctg
cggctcttccacggccgcggcggcaccgtcggccgcggtggcggcccctcgcacgacgcg
atcctcgcccagccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgag
gtcatctccgacaagtacctggtgccgtcgctggcccgggagaacctggagctgaccgtc
gcggccacactccaggcgtccgccctgcacaccgccccccgccagtccgacgaggcgctg
gcccgctgggacgccgcgatggacgtcgtgtcggacgccgcgcacgccgcgtaccgcagg
ctcgtcgaggacccggacctgccgacgtacttcctcgcgtcgacgccggtggaccagctc
gccgacctgcacctcggctcacggccctcccgccgccccggctcgggcgtctccctcgac
ggactgcgcgccatcccgtgggtgttcggctggacccagtcgcggcagatcgtgcccggc
tggttcggcgtcggctccggcctgaaggcgctgcgcgaggcgggcctggacaccgtgctc
gacgagatgcacgagcagtggcacttcttccgcaacttcgtctccaacgtggagatgacg
ctcgcgaagaccgacctgcgcatcgcccagcactacgtcgacaccctcgtccccgacgag
ctcaagcacgtgttcgacaccatcaaggccgagcacgaactgaccgtgcgcgaggtgctg
aaggtgaccggcgagacggagctgctcgacgcgaccccggcgctgcggcagaccttcagc
atccgggacgcctacctggacccgatctcctacctccaggtcgccctgctcaagcgtcag
cgcgacgcggcggccgcgggcgagcaggcggacccgctgctgtcgcgggcactgctgctg
accgtgaacggtgtggcggcggggctgcgcaacaccggctga

DBGET integrated database retrieval system