KEGG   Streptomyces davaonensis: BN159_5942Help
Entry
BN159_5942        CDS       T02518                                 

Gene name
mro
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00010  Glycolysis / Gluconeogenesis
sdv00052  Galactose metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
sdv01130  Biosynthesis of antibiotics
Module
sdv_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN159_5942 (mro)
   00052 Galactose metabolism
    BN159_5942 (mro)
Enzymes [BR:sdv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BN159_5942 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: CCK30321
UniProt: K4R249
LinkDB All DBs
Position
complement(6665550..6666695)
Genome map
AA seq 381 aa AA seqDB search
MELNRRTLIAGAAAAGVTAAMSGTAHATGGHRPVKSLFGKLADGTKIYSWSLENGGTRLK
VLSYGGIVQSLEIPDRRGRYTNVSLGFDNIEDYVASSPYFGALIGRFGNRIGKGKFTLDG
KDYQLSVNDGENSLHGGSKGFDKVVWDIEPFTKGSDVGLYLYYTSVDGEMGYPGTLRTKV
TYTLTRSGDWRIDYEATTDKATVVNLTSHVYWNLAGESSGTIYDHELSIAASRYTPVDSG
LIPTGELAKVAGTPFDFRRTKTVGEDIRVAHQQLLYGKGIDHNWVLDKGSTSRPQWVATL
RDPSSGRTLKIATTEPGLQFYSGNFLDGTLVGSGGSIYRQGDALCLETQHFPDSPNQPSF
PSTTLRPGQTYRTTTVHSFSA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacgctcatcgccggggcggcagccgccggtgtcaccgccgcc
atgagcggcaccgcacatgccacagggggccacaggccggtgaagtcgctcttcggcaag
ctcgccgacggcaccaagatctacagctggtcgctggagaacggcggcacccggctgaag
gtcctctcctacggcggcatcgtccagtccctggagatccccgaccggcgcggccgctac
acgaacgtctcgctgggcttcgacaacatcgaggactacgtcgcctccagcccctacttc
ggcgccctgatcggccggttcggcaaccgcatcggcaagggcaagttcaccctggacggc
aaggactaccagctctccgtcaacgacggcgagaacagcctgcacggcgggtccaagggc
ttcgacaaggtcgtctgggacatcgagccgttcaccaagggctccgacgtcggcctgtac
ctctactacacctccgtcgacggcgagatgggctaccccggcacgctgcgcacgaaggtc
acctacaccctgacccgctccggcgactggcgcatcgactacgaggccaccaccgacaag
gccaccgtcgtcaacctcaccagccacgtctactggaacctggccggcgagtccagcggc
acgatctacgaccacgagctgtcgatcgccgcctcccgctacacaccggtcgactcgggg
ctgatccccacgggcgagctggccaaggtggccggcactcccttcgacttccgccgcacc
aagaccgtcggcgaggacatccgcgtcgcccaccagcaactgctgtacggcaagggcatc
gaccacaactgggtcctggacaagggcagcacgtcccgtccgcagtgggtggcgaccctg
cgcgacccctcctccggccgcaccctgaagatcgccacgaccgagccggggctccagttc
tactcgggtaacttcctcgacggcaccctggtcggcagcggcggttcgatctaccgccag
ggcgacgcgctctgcctggagacgcagcacttcccggactcgccgaaccagccgtcgttc
ccgtccacaacgctgcgacctgggcagacgtaccggacgacgacggtgcactcgttcagt
gcgtga

DBGET integrated database retrieval system