KEGG   Streptomyces davaonensis: BN159_8045Help
Entry
BN159_8045        CDS       T02518                                 

Gene name
bgaB
Definition
(GenBank) Beta-galactosidase bgaB
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BN159_8045 (bgaB)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BN159_8045 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 ThuA Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: CCK32423
UniProt: K4RF33
LinkDB All DBs
Position
9000953..9002974
Genome map
AA seq 673 aa AA seqDB search
MPETSPKGLTRLAFGGDYNPEQWPESVWREDVRLMREAGVTMVSAGIFSWALLEPARGEY
DFGWLDRLLDLLHEGGIRVDLGTPTVVPPVWFYREHPEALPLAADGTRYEFGSRGAICHS
NADYRAAAANITTRLAERYADHPALAMWHVHNEYGVPVSACYCDSCAAHFRRWLATAYGT
VEAVNEAWGTAFWGQRYTAFEQINPPRTTPTVGNPAQALDYKRFADATMRENFVRERDIL
HRLAPGVPVTTNFMTALSQCDSVDYWAWGREVDIVTNDHYLITDGRRTHVNLAMAADLTR
SVAGGAPWILLEHSTSGVNWQPRNPAKAPGQMARNSLAHVARGSEGAMFFQWRQSRRGAE
KFHSAMLPHGGTDTRVWREVVELGASLDSLSTIRSTRTQADVAVLWDWHSWWAQTLDWRP
SEDHDPRERADAFYEALYDRHLTVDFAHPEADLSAYPLVVVPALYLMTEAAGNNLKEYVE
NGGTLVVSYFSGIVDEHDSVHEGACPGALRDVLGLTVEEFSPLLKGDTVRITGPDGSELT
GDVWTEFVVPREAETVWTYADGLTAHRPAVTRHRLGEGTAWYVSTRLDAHGLDALLGWAA
EDARIAPRADLPHDVEVVRRAGESGTYLFAINHSPSDAKVPLEAPGTELLTGERAAGRLE
VPAGAVRVVRLDG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaccagccccaagggcctcaccaggctcgccttcggtggggactacaacccc
gagcagtggccggaaagcgtctggcgcgaggacgtccggctgatgcgcgaggccggcgtg
acgatggtgagcgccgggatcttctcctgggcgctgctggagcccgcccgcggcgagtac
gacttcggctggctggaccgcctgctcgacctgctgcacgagggcggcatccgggtcgac
ctgggcacccccaccgtggtgccgccggtctggttctaccgggagcaccccgaggccctg
ccgctggccgccgacggcacgcgctacgagttcggctcccgcggcgccatctgccacagc
aacgccgactaccgcgccgccgccgcgaacatcaccacccggctcgcagagcgctacgcc
gaccacccggccctggccatgtggcacgtgcacaacgagtacggcgtccccgtctcggcc
tgctactgcgactcctgcgccgcccacttccgccgctggctggccaccgcctacggcacc
gtcgaggcggtgaacgaggcctggggcaccgccttctggggccagcgctacaccgccttc
gagcagatcaacccgccgcgcaccacaccgaccgtcggcaaccccgcccaggcgctggac
tacaagcggttcgccgacgccaccatgcgcgagaacttcgtccgcgagcgggacatcctg
caccgcctcgcgcccggcgtcccggtcacgaccaacttcatgaccgccctcagccagtgc
gactcggtcgactactgggcctggggccgtgaggtcgacatcgtcaccaacgaccactac
ctgatcaccgacggccgccgcacccacgtcaacctcgccatggccgccgacctcacccgc
tcggtcgccgggggagcgccctggatcctcctggagcactccacctcgggcgtcaactgg
cagccccgcaaccccgccaaggcccccggccagatggcccgcaactccctcgcccatgtg
gcgcgcggctccgagggcgccatgttcttccagtggcggcagtcccggcgcggcgccgag
aagttccactcggcgatgctcccgcacggcggcaccgacacccgcgtctggcgcgaggtc
gtcgagctcggcgcctccctggactccctgagcacgatccgctccacccgcacccaggcc
gacgtggccgtgctgtgggactggcactcctggtgggcgcagaccctcgactggcgcccc
agcgaggaccacgacccgcgcgagcgcgcggacgccttctacgaggccctctacgaccgc
cacctcaccgtcgacttcgcccaccccgaagccgacctgtcggcctaccccttggtcgtc
gtccccgcgctgtacctgatgacggaggcggccgggaacaacctcaaggagtacgtcgag
aacggcggcaccctcgtcgtgtcgtacttctccggcatcgtcgacgagcacgactccgtg
cacgagggcgcctgccccggggccctgcgggacgtcctgggcctgaccgtcgaggagttc
tcaccgctgctcaagggcgacaccgtccggatcaccggccccgacggctccgagctcacc
ggcgacgtatggaccgagttcgtggtgccgcgcgaggccgagacggtgtggacctacgcc
gacggactcaccgcgcaccgccccgcggtcacccggcaccggctcggcgagggcaccgcc
tggtacgtctccacccgcctcgacgcgcacggcctggacgccctcctcggatgggccgcc
gaggacgcccggatcgccccgcgcgccgatctgccgcacgacgtcgaggtggtccgccgc
gccggagagtccggcacctacctcttcgcgatcaaccacagcccgtcggacgccaaggtg
ccgctggaggcgcccggcaccgaactgctcacgggcgaacgggccgcgggccgcctcgaa
gtgcccgccggagccgtccgggtcgtccggctcgacggctga

DBGET integrated database retrieval system