KEGG   Shigella dysenteriae Sd197: SDY_0122Help
Entry
SDY_0122          CDS       T00306                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00473  D-Alanine metabolism
sdy00550  Peptidoglycan biosynthesis
sdy01100  Metabolic pathways
sdy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SDY_0122 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SDY_0122 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SDY_0122 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdy01011]
    SDY_0122 (ddl)
Enzymes [BR:sdy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SDY_0122 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sdy01011]
 Precursor biosynthesis
  Amino acid ligase
   SDY_0122 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_YheCD TTL ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 3799347
NCBI-ProteinID: YP_401846
ShiBASE_China: SDY0122
UniProt: Q32K00
LinkDB All DBs
Position
122887..123807
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVVPWVALTRA
EFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGQEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQAL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggtgggacctccgctgagcgggaagtttctttg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgacgcatatcctgtc
gacccgaaagaagtcgacgtgacgcaactgaagtcgatgggctttcagaaagtgtttatc
gcgctacacggccgcggcggtgaagatggtacgctgcagggcatgctcgagctgatgggc
ttgccttataccggaagcggagtgatggcatctgcgctttcaatggataaactacgcagc
aaacttctatggcaaggtgccggtttaccggtcgtgccgtgggtagcgttaacccgcgca
gagtttgaaaaaggtctgagcgataagcagttagcagaaatttctgctctgggtttgccg
gttatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggcaggagttcacggttgcgatactcggtgaagaaattttaccgtca
atacgtattcaaccgtccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccctgcaggtctggaagcgtcacaagaggccaatttgcaggcatta
gtgctgaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagcgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agcctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system