KEGG   Shigella dysenteriae Sd197: SDY_0196Help
Entry
SDY_0196          CDS       T00306                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00061  Fatty acid biosynthesis
sdy00780  Biotin metabolism
sdy01100  Metabolic pathways
sdy01212  Fatty acid metabolism
Module
sdy_M00083  Fatty acid biosynthesis, elongation
sdy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SDY_0196 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SDY_0196 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sdy01004]
    SDY_0196 (fabZ)
Enzymes [BR:sdy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SDY_0196 (fabZ)
Lipid biosynthesis proteins [BR:sdy01004]
 Fatty acid synthase
  Component type
   SDY_0196 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-GeneID: 3798543
NCBI-ProteinID: YP_401917
ShiBASE_China: SDY0196
UniProt: Q32JS9
LinkDB All DBs
Position
202363..202818
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagaacttctgccgcaccgt
ttcccgttcttactggtggatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtctctgtcaatgagccattcttccagggccatttccctggaaaaccgatt
ttcccgggtgtgctgattctggaagcaatggcacaggcaacaggtattctggcgtttaaa
agcgtaggaaaactggaaccgggtgagctgtactatttcgctggtattgatgaagcgcgc
ttcaagcgcccggtcgtgcctggcgatcaaatgatcatggaagtcactttcgaaaaaacg
cgccgcggcctgacccgttttaaaggggttgctctggtcgacggtaaagtagtttgcgaa
gcaacgatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system