KEGG   Shigella dysenteriae Sd197: SDY_1088Help
Entry
SDY_1088          CDS       T00306                                 

Gene name
amyA
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00500  Starch and sucrose metabolism
sdy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDY_1088 (amyA)
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDY_1088 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-GeneID: 3797830
NCBI-ProteinID: YP_402742
ShiBASE_China: SDY1088
UniProt: Q32HF4
LinkDB All DBs
Position
complement(1015751..1017238)
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYINQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gcacaactgctggccgccattgacgctctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgacgaccgtacgcaaattgatgaagaaatcattgagtgcgaaggctggacgcgt
tacaccttccccgcccgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgacgaagatggcatttttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaattaggtaatttcgattatctg
atgggtgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacacaatgcgacggttttcgtcttgatgcggtcaaacatatt
ccggcgtggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcagagtactggtcgcatgaagtcgataaactgcaaacgtatattaatcag
gtggaaggcaaaaccatgctgttcgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatggggcgcgactacgacatgacgcagattttcacgggtacattagtggaagccgat
cctttccacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtattctatccggacctctacggtgcgcattacgaagatgtcggcggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcactgacgaatatcccggctgcgtggtggtcatgtcgaacggg
gatgatggcgaaaaaaccattcatctgggagagaattacggcaacaaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgaccgacgaaaacggcgaagcaaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system