KEGG   Shigella dysenteriae Sd197: SDY_1493Help
Entry
SDY_1493          CDS       T00306                                 

Gene name
ydjJ
Definition
(RefSeq) oxidoreductase
Organism
sdy  Shigella dysenteriae Sd197
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-GeneID: 3797505
NCBI-ProteinID: YP_403123
ShiBASE_China: SDY1493
UniProt: Q32GC3
LinkDB All DBs
Position
1369320..1370327
Genome map
AA seq 335 aa AA seqDB search
MKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQEIGLGHECAGTVVA
VGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPNYRGALTHYLCHPE
SFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCIGLMTLQACKCLGA
TEIAVVDVLEKRLAMAELLGATVVINGAKEDTIARCQQFTEDMGADIVFETAGSAVTVKQ
APYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVTIEAISSGRFDVKS
MVTHIYDYRGNDSNLLIVFYVQIMPDDFVMQLHRF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatttcagcagaaataccagtgcctaaagaagatgaagttttgattaaagta
gaatatgtcggtatttgtggttcagatgtacatggttttgaatcaggtccgtttattccg
cctaaagacccaaatcaagaaattggcctaggtcatgaatgcgccgggacggttgtggct
gtgggaagccgtgtgcgcaaatttaaaccgggggatcgggtaaatatcgaacctggcgtt
ccttgcggtcactgtcgttactgtctggaaggcaaatataacatctgcccggacgttgat
tttatggcgacacaacccaactaccgcggcgcattaacgcactatctgtgtcatccggag
agctttacttacaaactgcccgacaatatggacacgatggaaggggcgctggtggagcct
gccgcagtcgggatgcatgccgcgatgctggcagatgttaaaccgggtaagaagataatt
attctgggagcaggttgtattggtttgatgacgttgcaagcgtgcaaatgcctgggagca
acggaaattgccgtcgttgatgtgctggaaaaacgtctggcaatggcggaactgcttggt
gcgacagtggttattaacggcgcaaaagaagacactattgcacgctgtcagcaatttacc
gaagacatgggcgcagatattgttttcgaaacagcgggttctgcggtcaccgttaaacag
gcaccttatctggtaatgcgcggcggtaaaattatgattgttggtactgtacccggcgat
tcggcaatcaatttcctcaaaataaatcgcgaagtcactatccagacggtattccgctat
gccaatcgttatccggtcacgattgaagctatttcttcagggcgattcgatgtgaaatcg
atggtgacgcatatttacgattatcggggtaatgactctaacttattgatagtgttttat
gttcagataatgcccgatgactttgtcatgcagctccaccgattttga

DBGET integrated database retrieval system