KEGG   Shigella dysenteriae Sd197: SDY_2058Help
Entry
SDY_2058          CDS       T00306                                 

Gene name
fabD
Definition
(RefSeq) malonyl CoA-ACP transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00061  Fatty acid biosynthesis
sdy01100  Metabolic pathways
sdy01130  Biosynthesis of antibiotics
sdy01212  Fatty acid metabolism
Module
sdy_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SDY_2058 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SDY_2058 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sdy01004]
    SDY_2058 (fabD)
Enzymes [BR:sdy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     SDY_2058 (fabD)
Lipid biosynthesis proteins [BR:sdy01004]
 Fatty acid synthase
  Component type
   SDY_2058 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1
Motif
Other DBs
NCBI-GeneID: 3799529
NCBI-ProteinID: YP_403644
ShiBASE_China: SDY2058
UniProt: Q32EV2
LinkDB All DBs
Position
complement(1869332..1870261)
Genome map
AA seq 309 aa AA seqDB search
MTQFAFVFPGQGSQTVGMLTDMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW
QTQPALLTASVALYCVWQQQGGKAPALMAGHSQGEYSALVCAGVIDFADAVRLVEMRGKF
MQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAG
AACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNG
DAIRDALVRQLYNPVQWTKSVEYMAARGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEP
SAMAAALEL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatttgcatttgtgttccctggacagggttctcaaaccgttggaatgctgact
gatatggcggcgagctatccaattgttgaagaaacgtttgctgaagcttctgcggcgctg
ggctacgacctgtgggcgctgacccagcaggggccagctgaagaactgaataaaacctgg
caaacccagccagcgctgttgactgcatctgttgcgctgtactgcgtatggcagcagcag
ggcggtaaagcaccggcattgatggccggtcacagccagggggaatactccgcgctggtt
tgcgctggtgtgattgatttcgctgatgcggtgcgtctggttgagatgcgcggcaagttc
atgcaagaagccgtaccggaaggtacgggcgctatggcggcaatcatcggtctggatgat
gcgtctattgcgaaagcgtgtgaagaagctgcagaaggtcaggtcgtttctccggtaaac
tttaactctccgggacaggtggttattgccggtcataaagaagcggttgagcgtgctggc
gctgcctgtaaagctgcgggcgcaaaacgcgctctgccgttaccagtgagcgtaccgtct
cactgtgcgctgatgaaaccagcagccgacaaactggcagtagaattagcgaaaatcacc
tttaacgcaccaacagttcctgttgtgaataacgttgatgtgaaatgcgaaaccaatggt
gatgccattcgtgacgcactggtacgtcagttgtataacccggttcagtggacgaagtct
gttgagtacatggcagcgcgaggcgtagaacatctctatgaagtcggcccgggcaaagtg
cttactggcctgacgaaacgcattgtcgacaccctgaccgcctcggcgctgaacgaacct
tcagcgatggcagcggcgctcgagctttaa

DBGET integrated database retrieval system