KEGG   Shigella dysenteriae Sd197: SDY_2436Help
Entry
SDY_2436          CDS       T00306                                 

Gene name
glpA
Definition
(RefSeq) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00564  Glycerophospholipid metabolism
sdy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SDY_2436 (glpA)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SDY_2436 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-GeneID: 3798237
NCBI-ProteinID: YP_404000
ShiBASE_China: SDY2436
UniProt: Q32DU6
LinkDB All DBs
Position
2238028..2239656
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYVDLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYDEIDDNRVRAEEVDILLREGEKLAP
VMAQTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRRLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccggaattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgcattagtgaaaaccagatcctgaaacgc
attgcacgtcactgcgttgaaccaaccaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttattcgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaacatgctggat
gccaaagaacacggtgccgttatccttaccgctcatgaagtcacgggactgattcgtgaa
ggcgcgacggtgtgcggtgttcgtgtacgtaaccatctcaccggcgaaactcaggccctt
catgcacctgtcgtggttaatgccgctgggatctgggggcaacacattgccgaatatgtc
gatctgcgcattcgcatgttcccggcgaaaggatcgctgctgatcatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgcaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctgattggcaccacctcattacgtattgattacgacgagatcgacgat
aaccgggtgagggcagaagaagtggatatcctgctgcgtgaaggggaaaaactggccccc
gtgatggcgcaaacgcgcattttgcgggcctactctggcgtgcgcccgctggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggctgaatgggctaccgacgcggtatgccgcaaactgggcaacacgcgcccctgtacg
accgccgatctggcacttccgggttcacaggaacccgctgaagttacattgcgtaaagtc
atctccctgcctgccccgctgcgcggttctgcagtttatcgtcatggcgatcgcacgcct
gcctggctgagcgaaggccgtctgcaccgtagactggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcggtagaaaatttaaacgttaatagcctgctggatttacgc
cgtcgtacccgtgtggggatgggtacctgccagggcgaactctgcgcctgccgcgctgct
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatcgcctggggagatgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system