KEGG   Shigella dysenteriae Sd197: SDY_P160
Entry
SDY_P160          CDS       T00306                                 

Gene name
ipaJ
Definition
(RefSeq) IpaJ
  KO
K23832  cysteine protease IpaJ [EC:3.4.22.-]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SDY_P160 (ipaJ)
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     SDY_P160 (ipaJ)
SSDB
Other DBs
NCBI-GeneID: 3776564
NCBI-ProteinID: YP_406161
ShiBASE_China: SDYP160
UniProt: Q326T5
LinkDB
Position
pSD1_197:126261..126944
AA seq 227 aa
MISHQTDVRVNENRVNEQGCFLARKQMYDNSCGAASLLCAAKELGVDKIPQYKGSMSEMT
RKSSLDLDNRCERDLYLITSGNYNPRTHKDNIADAGYSMPDKIVMATRLLGLNAYVVEES
NIFSQVISFIYPDARDLLIGMGCNIVHQRDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRP
DGSYMDPAVGENYSCFSTMELGARRSNSNFIGYTKIGISIVITNEAL
NT seq 684 nt   +upstreamnt  +downstreamnt
atgatatctcatcagactgatgtgagggtaaatgagaatagagtaaacgaacaaggttgt
tttttggcgaggaagcagatgtatgacaattcttgtggagctgccagtttactctgtgct
gcaaaggaattaggggttgataaaataccacaatacaaagggtctatgtccgaaatgaca
aggaagagttctcttgatttggataatcgttgtgagcgggatttatacttaataactagt
ggtaattataatccgagaacacacaaagataatatcgcggatgccggttattctatgcct
gataagatagtcatggctacgaggcttcttggattgaatgcttatgtcgttgaagaaagt
aacattttttcgcaagtaattagttttatttatcccgatgcaagggacttattaattggc
atgggatgtaatatagtacatcaacgagatgtgttatcttctaaccaaagagttttggaa
gctgttgctgtatcctttattggagttcctgtcggcctccactgggtgttgtgtagacct
gatggaagctatatggatccagctgtaggagaaaattattcttgtttttcaactatggaa
ttaggtgcaagaagaagtaattctaactttataggatatactaaaataggtatttccata
gttataactaatgaggctttgtaa

DBGET integrated database retrieval system