KEGG   Shigella dysenteriae Sd197: SDY_P224
Entry
SDY_P224          CDS       T00306                                 

Gene name
icsP
Definition
(RefSeq) outer membrane protease
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SDY_P224 (icsP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sdy01002]
    SDY_P224 (icsP)
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     SDY_P224 (icsP)
Peptidases and inhibitors [BR:sdy01002]
 Aspartic peptidases
  Family A26: omptin family
   SDY_P224 (icsP)
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-GeneID: 3776504
NCBI-ProteinID: YP_406225
ShiBASE_China: SDYP224
UniProt: Q326M1
LinkDB
Position
pSD1_197:181408..182355
AA seq 315 aa
MKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERVYHPKEGGRKIS
QLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNSNTPQIWTDQSW
HPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYIYSENGGNRNKK
GAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVRSSDTDKHYQTETIFK
DEIKNQNYRSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTNISGTIKNSASI
EYIGFLTSAGIKYIF
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaaattaaaattccttgtacttgcactttgtgtacctgcgatctttactacacatgct
accactaactatccacttttcataccggacaacatcagtacggatattagtctaggatct
ctgagtggcaaaacaaaagaacgcgtttatcatcccaaggaaggggggagaaaaattagt
caactggactggaaatacagtaatgcgactattgttagaggtggcatcgattggaagcta
attccaaaagtgtctttcggagtttccggttggactactttaggtaaccagaaagcaagc
atggttgataaagactggaacaattccaatacccctcagatatggaccgaccagagctgg
catcccaatacgcatctccgtgatgctaacgaattcgagctgaatcttaaaggttggtta
ttaaataatttggattatcgacttggactaatagcaggttaccaagagagtcgttacagt
tttaatgcaatgggagggagttatatttatagtgaaaacggggggaacaggaataaaaaa
ggggcacatcctagtggtgaaagaacaataggttacaaacagctcttcaaaataccttat
attggattaactgctaattaccgccatgagaattttgagtttggagcagaactgaaatat
agtggttgggttcgttcatctgatacagataaacactatcagactgagacaatttttaaa
gatgaaataaaaaaccaaaattaccgctctgttgctgcaaatattggatactatgtcacc
cccagtgcaaaattttatatagaaggatccagaaattacatttctaataaaaaaggtgat
acatctctttatgagcaaagtaccaatatatctggcaccattaaaaatagtgcaagtatt
gaatatattggttttctcacttccgcaggtataaagtatattttttga

DBGET integrated database retrieval system