KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_00868Help
Entry
Asd1617_00868     CDS       T02933                                 

Definition
(GenBank) TolA protein
  KO
K03646  colicin import membrane protein
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdz02000]
    Asd1617_00868
Transporters [BR:sdz02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Asd1617_00868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHA63695
UniProt: A0A0A6ZP89
LinkDB All DBs
Position
638698..639540
Genome map
AA seq 280 aa AA seqDB search
MSKAIEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGGGGSSIDAVMVDSGAV
VEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLKQLEKERLAAQEQKKQA
EEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKAAADAKKKAEAEAAKAAA
EAQKKAEAAAAALKKKAEAAEAAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKA
AAAKAAAEADDIFGELSSGKNAPENGGRGEREQCFACREW
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaggcaatcgaacaaaacgacaagctcaagcgggcgataattatttcagcagtg
ctgcatgtcatcttatttgcggcgctgatctggagttcgttcgatgagaatatagaagct
tcagccggaggcggcggtggttcgtccatcgacgctgtcatggttgattcaggtgcggta
gttgagcagtacaaacgcatgcaaagccaggaatcaagcgcgaagcgttctgatgagcag
cgcaagatgaaggaacagcaggctgctgaagaactgcgtgagaaacaagcggctgaacag
gaacgcctgaagcaacttgagaaagagcggttagctgctcaggaacagaaaaagcaggct
gaagaagccgcaaaacaggccgagttaaagcagaagcaagcggaagaggcggcagcgaaa
gcggcggcagatgctaaagcgaaggccgaagcggatgctaaagctgcggaagaagcagcg
aagaaagcggctgcagacgcgaagaaaaaagcagaagcagaagccgccaaagccgcagcc
gaagcgcagaaaaaagccgaggcagccgctgcggcactgaagaagaaagcggaagcggca
gaagcagcagcagctgataagaaagcggcagcagagaaagctgcagccgacaaaaaagca
gcagaaaaagcggctgctgaaaaggcagcagctgataagaaagcagcggcagaaaaagcc
gctgcagcaaaagctgccgcagaggcagatgatattttcggtgagctaagctctggtaag
aatgcaccggaaaacggggggaggggcgaaagggaacaatgcttcgcttgccgggagtgg
taa

DBGET integrated database retrieval system