KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_01168Help
Entry
Asd1617_01168     CDS       T02933                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00061  Fatty acid biosynthesis
sdz01100  Metabolic pathways
sdz01212  Fatty acid metabolism
Module
sdz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Asd1617_01168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sdz01004]
    Asd1617_01168
Enzymes [BR:sdz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Asd1617_01168
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     Asd1617_01168
Lipid biosynthesis proteins [BR:sdz01004]
 Fatty acid synthase
  Component type
   Asd1617_01168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AHA63995
UniProt: A0A0A6ZQ81
LinkDB All DBs
Position
complement(864098..864724)
Genome map
AA seq 208 aa AA seqDB search
MAITLAELVYSELIGLVQRTRVSYPACFNKIRLTENMVDKRESYTKEDLLASGRGELFGA
KGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGL
DAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLA
DGEVLVDGRLIYTASDLKVGLFQDTSAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccattacgttggctgaactggtttattccgaactgatcggacttgttcagcgtaca
cgtgttagctatcctgcgtgcttcaataaaataaggcttacagagaacatggtagataaa
cgcgaatcctatacaaaagaagaccttcttgcctctggtcgcggtgaactgtttggcgct
aaaggcccgcaattgccagcaccgaacatgctgatgatggaccgtgtggtcaaaatgacc
gaaacgggtggtaacttcgacaaagggtatgttgaagcagaactggatatcaatccggat
ctgtggttcttcggatgccactttattggcgatccggttatgccgggatgcctgggcctg
gacgcaatgtggcagctggtagggttctacctcggctggctgggcggcgaaggtaaaggc
cgcgcgctgggcgttggcgaagtgaaattcactggtcaggtactgccgacagcgaaaaaa
gtgacctaccgtattcactttaaacgcattgttaatcgtcgtctgattatgggtctggca
gatggcgaagtgctggttgatggtcgtctgatctatactgccagcgacctgaaagtcggt
ctgttccaggatacgtctgccttctga

DBGET integrated database retrieval system