KEGG   Shigella dysenteriae 1617: Asd1617_01693Help
Entry
Asd1617_01693     CDS       T02933                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sdz  Shigella dysenteriae 1617
Pathway
sdz00240  Pyrimidine metabolism
sdz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Asd1617_01693
Enzymes [BR:sdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Asd1617_01693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: AHA64520
UniProt: A0A0A6ZRQ8
LinkDB All DBs
Position
1176009..1176632
Genome map
AA seq 207 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFAEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEVGSVNGYSGISGDASN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagctcgcgtataggtttgtcatcgcctgcaaaa
ttatttaaccaaaattcatcattatttgccgagattcgtgcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtagatcaactcgatatacccgtactttgttatggtttacgtacagatttt
cgaggtgaattatttattggtagccaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggcgagcaggtggttattggtggtaatgaacgctacgtttct
gtatgccgtaaacactataaagaggcgttagaagtcggctcagttaacggctattcagga
atttctggtgatgcttccaattag

DBGET integrated database retrieval system