KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_02530Help
Entry
Asd1617_02530     CDS       T02933                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Brite
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Asd1617_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHA65357
UniProt: E2XG20
LinkDB All DBs
Position
1677416..1677997
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcatatttct
gcggaaaccatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgatcaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggcgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgccggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagctcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccactgaccaccgatgcgactccgctgctgaccgttgatgtctgggaa
cacgcatattacatcgattatcgcaatgcacgtcctggctatctggagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system