KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_03056
Entry
Asd1617_03056     CDS       T02933                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00052  Galactose metabolism
sdz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Asd1617_03056
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Asd1617_03056
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N PrmA Methyltransf_25 ELFV_dehydrog FAD_binding_2 MTS ThiF
Other DBs
NCBI-ProteinID: AHA65883
UniProt: E2XET9
LinkDB
Position
complement(2016905..2017945)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPSDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRNNVFALPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLSLAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtaggatccggtgttgatgatttacaccctagcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaaggattttat
tcccaatgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcgaaacaatgtctttgcactacctgcggatatgcctattgaggatggg
gcttttattgaaccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggccattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactgtcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system