KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_03417Help
Entry
Asd1617_03417     CDS       T02933                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00071  Fatty acid degradation
sdz00280  Valine, leucine and isoleucine degradation
sdz00281  Geraniol degradation
sdz00310  Lysine degradation
sdz00362  Benzoate degradation
sdz00380  Tryptophan metabolism
sdz00410  beta-Alanine metabolism
sdz00640  Propanoate metabolism
sdz00650  Butanoate metabolism
sdz00903  Limonene and pinene degradation
sdz00930  Caprolactam degradation
sdz01100  Metabolic pathways
sdz01110  Biosynthesis of secondary metabolites
sdz01120  Microbial metabolism in diverse environments
sdz01130  Biosynthesis of antibiotics
sdz01200  Carbon metabolism
sdz01212  Fatty acid metabolism
Module
sdz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Asd1617_03417
   00650 Butanoate metabolism
    Asd1617_03417
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Asd1617_03417
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Asd1617_03417
   00310 Lysine degradation
    Asd1617_03417
   00380 Tryptophan metabolism
    Asd1617_03417
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Asd1617_03417
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Asd1617_03417
   00281 Geraniol degradation
    Asd1617_03417
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Asd1617_03417
   00930 Caprolactam degradation
    Asd1617_03417
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Asd1617_03417
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Asd1617_03417
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Asd1617_03417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AHA66244
UniProt: E2X5Q1
LinkDB All DBs
Position
complement(2293192..2295336)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQDQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLSLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELVMTPQSQALRSIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVIAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtttggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagctctggcgcggcaggaccaacagttgatggcggagattcatgctttg
cccattccggttattgccgctattcatggcgcttgcctgggcggtgggctggagctggcg
ctcgcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcagtttgcctgaa
gtacaacttggattgttacccggttcaggtggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgattctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgtcgttccgcactccattctgctggaagccgctgttgag
ctggcaaagcaggatcgtccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagtggctatgacgctgaagcacgggcgtttggcgaactggtgatgacgcca
caatcgcaagctttgcggagtatcttttttgccagtacggaagtgaagaaagatcccggt
agtgatgcgccgcctgcgccattaaacagcgtgggaattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgggtacatcagcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtgattgcaataatgcaacga
ctggccacgcagtatggttcacgttttaccccttgcgagcgtttagtcgagatgggtgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system