KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_04046Help
Entry
Asd1617_04046     CDS       T02933                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00051  Fructose and mannose metabolism
sdz01100  Metabolic pathways
sdz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Asd1617_04046
Enzymes [BR:sdz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Asd1617_04046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AHA66873
UniProt: A0A0A6ZXR5
LinkDB All DBs
Position
complement(2741304..2741849)
Genome map
AA seq 181 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKRYGWRMKLKCWRNF
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacatgcctggaaatgacccgcctg
ggactgaaccaggggacagcggggaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggtattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggtaaacatgaggaaggaaagctaccctcaagcgagtggcgtttccatatggcggcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgcacggca
gtttccattcttaaccgatcgatccccgctattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgcgaactttctgaacatgtt
gcgctggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggtgaatctggaaaagcgttatggctggcgcatgaagttgaagtgctggcgcaacttt
acctga

DBGET integrated database retrieval system