KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_04825Help
Entry
Asd1617_04825     CDS       T02933                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00564  Glycerophospholipid metabolism
sdz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Asd1617_04825
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Asd1617_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHA67652
UniProt: A0A0A7A0A1
LinkDB All DBs
Position
complement(3326733..3328253)
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKV
YNAHFKKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQDIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYARTYGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGM
WLNADQQSRVSQWLVEYTQQKLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggtggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcgcag
gatctcgcttgcgcgacctcttccgccagttcaaaactcattcacggtggcctgcgctac
cttgagcactatgaattccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctg
aaaatggccccgcatatcgccttcccgatgcgttttcgcctgccacatcgtccgcatctg
cgcccggcgtggatgattcgcattggtctgtttatgtacgatcatctgggtaaacgcacc
agcctgccgggatcaactggtttgcgttttggcgcaaattcagtgttaaaaccggaaatt
aagcgcggattcgaatattccgactgttgggtagacgatgcccgtctggtgctcgccaac
gcccagatggtggtgcgtaaaggcggcgaagtgcttactcgtactcgtgctacttctgct
cgtcgcgaaaacggcctgtggattgtggaagcggaagatatcgataccggcaaaaaatat
agctggcaagcgcgcggcctggttaacgccaccggcccgtgggtgaaacagttcttcgac
gacgggatgcatctgccttcgccttatggcatccgcctgatcaaaggcagccatattgtg
gtgccacgcgtgcatacccagaagcaagcctacattctgcaaaacgaagataaacgtata
gtgttcgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggaatac
aaaggcgatccgaaagcagtgaagattgaagagagtgaaatcaattacctgctgaaagtg
tataacgcgcactttaaaaaacagcttagccgtgacgatatcgtctggacctactccggt
gtgagaccactatgtgatgatgaatccgactcgccgcaggctattacccgtgattacacc
cttgatattcatgatgaaaatggcaaagcaccgctgctgtcggtattcggcggtaagctg
accacctaccgcaaactggcggaacatgcgctggaaaaactaacgccgtattatcaggat
attggcccggcatggacgaaagagagcgtgctaccgggtggcgccatcgagggcgaccgc
gatgactacgccgcccgcctgcgccgccgttacccgttcctgactgaatcgctggcacgt
cactacgcgcgcacttacggcagcaacagcgagctgctgctcggcaatgcgggggcgata
agcgacctcggggaggatttcggtcatgagttctacgaagcagagctgaaatatctggtc
gaccacgaatgggtccgtcgcgccgacgatgccttgtggcgtcgcacaaaacaaggcatg
tggctgaatgcggatcaacaatctcgtgtgagtcagtggctggtagagtatacgcagcag
aagttgtcgctggcgtcgtaa

DBGET integrated database retrieval system