KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_04873Help
Entry
Asd1617_04873     CDS       T02933                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sdz01100  Metabolic pathways
sdz01110  Biosynthesis of secondary metabolites
sdz01130  Biosynthesis of antibiotics
sdz01230  Biosynthesis of amino acids
Module
sdz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asd1617_04873
Enzymes [BR:sdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Asd1617_04873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK TsaE AAA_16 AAA AAA_22 AAA_7 ABC_tran APS_kinase RsgA_GTPase IstB_IS21 His_biosynth AAA_PrkA AAA_5 Ploopntkinase3 AAA_17 RNA_helicase AAA_25 AAA_29 G-alpha TniB PduV-EutP AAA_28 Zeta_toxin Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AHA67700
UniProt: A0A0A7A0J2
LinkDB All DBs
Position
3370517..3371239
Genome map
AA seq 240 aa AA seqDB search
MVARQRACSDQICRGMGDLFSCQTRWSIEIIFSLTLAISYEVSVHVLRRSLSEAGLSLTN
SLSSTEKMAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDL
EGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLAR
TQRDKKRPLLHVETPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggtagcaaggcagcgcgcttgcagcgaccagatatgcagagggatgggtgatttattc
agttgccaaacccgctggagtattgagataattttcagtctgactctcgcaatatcttat
gaggtttcagttcatgtcctgcggcgctctctgagcgaagcgggtttatcattaacgaat
agtcttagtagtaccgaaaaaatggcagagaaacgcaatatctttctggttgggcctatg
ggtgccggaaaaagcactattgggcgccagttagctcaacaactcaatatggaattttac
gattccgatcaagagattgagaaacgaaccggagctgatgtgggctgggttttcgattta
gaaggcgaagaaggcttccgcgatcgcgaagaaaaggtcatcaatgagttgaccgagaaa
cagggtattgtgctggctactggcggcggctctgtgaaatcccgtgaaacgcgtaaccgt
ctttccgctcgtggcgttgtcgtttatcttgaaacgacgatcgaaaagcaacttgcacgc
acgcagcgtgataaaaaacgcccgttgctgcacgttgaaacaccgccgcgtgaagttctg
gaagcgttggccaatgaacgcaatccgctgtatgaagagattgccgacgtgaccattcgt
actgatgatcaaagcgctaaagtggttgcaaaccagattattcacatgctggaaagcaac
taa

DBGET integrated database retrieval system