KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_06357
Entry
Asd1617_06357     CDS       T02933                                 

Definition
(GenBank) Invasion plasmid antigen
  KO
K23832  cysteine protease IpaJ [EC:3.4.22.-]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    Asd1617_06357
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Asd1617_06357
SSDB
Other DBs
NCBI-ProteinID: AHA69184
UniProt: A0A0A7A514
LinkDB
Position
pSLG231:122611..123426
AA seq 271 aa
MLDAILCCNYSSMSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNENRVN
EQGCFLARKQMYDNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNRCERDLY
LITSGNYNPRTHKDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVISFIYPDARD
LLIGMGCNIVHQRDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMDPAVGENYSCF
STMELGARRSNSNFIGYTKIGISIVITNEAL
NT seq 816 nt   +upstreamnt  +downstreamnt
ttgctggatgcaatactgtgctgcaattactcgtcgatgtcggaacaacggaagccttgc
aaacggggatgtattcatacaggtgttatgttatatggggttttattgcagggggctata
ccaagagaatatatgatatctcatcagactgatgtgagggtaaatgagaatagagtaaac
gaacaaggttgttttttggcgaggaagcagatgtatgacaattcttgtggagctgccagt
ttactctgtgctgcaaaggaattaggggttgataaaataccacaatacaaagggtctatg
tccgaaatgacaaggaagagttctcttgatttggataatcgttgtgagcgggatttatac
ttaataactagtggtaattataatccgagaacacacaaagataatatcgcggatgccggt
tattctatgcctgataagatagtcatggctacgaggcttcttggattgaatgcttatgtc
gttgaagaaagtaacattttttcgcaagtaattagttttatttatcccgatgcaagggac
ttattaattggcatgggatgtaatatagtacatcaacgagatgtgttatcttctaaccaa
agagttttggaagctgttgctgtatcctttattggagttcctgtcggcctccactgggtg
ttgtgtagacctgatggaagctatatggatccagctgtaggagaaaattattcttgtttt
tcaactatggaattaggtgcaagaagaagtaattctaactttataggatatactaaaata
ggtatttccatagttataactaatgaggctttgtaa

DBGET integrated database retrieval system