KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_06409
Entry
Asd1617_06409     CDS       T02933                                 

Definition
(GenBank) Outer membrane protease
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    Asd1617_06409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sdz01002]
    Asd1617_06409
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     Asd1617_06409
Peptidases and inhibitors [BR:sdz01002]
 Aspartic peptidases
  Family A26: omptin family
   Asd1617_06409
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-ProteinID: AHA69236
UniProt: A0A0A7A5C6
LinkDB
Position
pSLG231:176330..177310
AA seq 326 aa
MDISTKKVEFSMKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERV
YHPKEGGRKISQLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNS
NTPQIWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYI
YSENGGNRNKKGAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVRSSDT
DKHYQTETIFKDEIKNQNYRSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTN
ISGTIKNSASIEYIGFLTSAGIKYIF
NT seq 981 nt   +upstreamnt  +downstreamnt
atggacatttcaaccaaaaaagtagagttctcgatgaaattaaaattccttgtacttgca
ctttgtgtacctgcgatctttactacacatgctaccactaactatccacttttcataccg
gacaacatcagtacggatattagtctaggatctctgagtggcaaaacaaaagaacgcgtt
tatcatcccaaggaaggggggagaaaaattagtcaactggactggaaatacagtaatgcg
actattgttagaggtggcatcgattggaagctaattccaaaagtgtctttcggagtttcc
ggttggactactttaggtaaccagaaagcaagcatggttgataaagactggaacaattcc
aatacccctcagatatggaccgaccagagctggcatcccaatacgcatctccgtgatgct
aacgaattcgagctgaatcttaaaggttggttattaaataatttggattatcgacttgga
ctaatagcaggttaccaagagagtcgttacagttttaatgcaatgggagggagttatatt
tatagtgaaaacggggggaacaggaataaaaaaggggcacatcctagtggtgaaagaaca
ataggttacaaacagctcttcaaaataccttatattggattaactgctaattaccgccat
gagaattttgagtttggagcagaactgaaatatagtggttgggttcgttcatctgataca
gataaacactatcagactgagacaatttttaaagatgaaataaaaaaccaaaattaccgc
tctgttgctgcaaatattggatactatgtcacccccagtgcaaaattttatatagaagga
tccagaaattacatttctaataaaaaaggtgatacatctctttatgagcaaagtaccaat
atatctggcaccattaaaaatagtgcaagtattgaatatattggttttctcacttccgca
ggtataaagtatattttttga

DBGET integrated database retrieval system