KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4360Help
Entry
SeAg_B4360        CDS       T00751                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00620  Pyruvate metabolism
sea00680  Methane metabolism
sea01100  Metabolic pathways
sea01120  Microbial metabolism in diverse environments
sea01200  Carbon metabolism
Module
sea_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeAg_B4360 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SeAg_B4360 (ppc)
Enzymes [BR:sea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SeAg_B4360 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACH50907
UniProt: B5F0U5
LinkDB All DBs
Position
complement(4254065..4256803)
Genome map
AA seq 912 aa AA seqDB search
MTWVGERSQRRRSVKDAGQLQQRWGVWDHMNEQYSALRSNVSMLGKVLGETIKDALGEHI
LDRVETIRKLSKSSRAGNEANRQELLTTLQNLSNDELLPVARAFSQFLNLANTAEQYHSI
SPKGEAASNPEVIARTLRKLKNQPDLNDATIKKAVESLSLELVLTAHPTEITRRTLIHKM
GEINNCLKQLDNTDIADYERHQVMRRLRQLIAQSWHTDEIRKQRPSPVDEAKWGFAVVEN
SLWQGVPNYLRELNEQLEENLGYKLPVDFVPVRFTSWMGGDRDGNPNVTADITRHVLLLS
RWKATDLFLKDIHVLVSELSMVDATPELLALVGEEGASEPYRYLMKKLRARLMATQSWLE
ARLKGEKLPKPAGLLTQNEQLWEPLYACYQSLQACGMGIIANGELLDTLRRVKCFGVPLV
RIDIRQESTRHTEALGEITRYLGIGDYESWSEADKQAFLIRELNSKRPLLPRNWEPSNDT
REVLETCKVIAEAPKGSIAAYVISMAKTPSDVLAVHLLLKEAGIGFAMPVAPLFETLDDL
NNADDVMTQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKA
GIELTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPEVTVSSL
SLYTSAILEANLLPPPEPKDSWRHIMDELSVISCETYRGYVRENKDFVPYFRSATPEQEL
GKLPLGSRPAKRRPTGGVESLRAIPWIFAWTQNRLMLPAWLGAGTALQKVVEDGKQSELE
AMCRDWPFFSTRLGMLEMVFSKADLWLADYYDQRLVAKTLWPLGKELRDLLEEDIKVVLA
IANDSHLMADLPWIAESIQLRNVYTDPLNVLQAELLYRSRLTEEQGKSPDPRVEQALMVT
IAGVAAGMRNTG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgggtgggagagcgcagccaacgccgccgcagcgtgaaagatgcaggacaatta
caacagagatggggtgtctgggatcatatgaacgaacaatattccgcgttgcgtagtaat
gtcagtatgctcggcaaggtgctgggagaaaccatcaaggatgcgctgggagaacacatt
cttgatcgcgtagaaacaatccgtaagctatccaaatcttcacgcgccggcaatgaagct
aatcgccaggagctgctcaccacgctacaaaatttgtctaatgacgagctgctgccagtt
gcgcgcgcgtttagtcagttcctgaacctggccaatactgccgagcaataccacagcatt
tcgccaaaaggcgaagccgccagcaacccggaagtgattgcccgcactctgcgtaaactg
aaaaaccaaccggacctcaacgacgcaaccatcaaaaaagcggtagagtcgctgtctctg
gagttggtgctaaccgcccatccgacagaaattacccgccgtacgcttattcacaaaatg
ggtgaaatcaacaactgtctgaaacagcttgataataccgatatcgccgactacgaacgc
caccaggtaatgcgtcgcctgcgccagttgattgcccaatcctggcatacggatgagatc
cgcaagcagcgtccaagcccggtggatgaagccaaatggggcttcgccgtggttgagaac
agcctgtggcagggcgtacctaactatctgcgtgaactgaacgaacagctggaagaaaat
ctcggctacaaattgccggtggattttgtgccggtacgttttacctcctggatgggcggc
gaccgtgacggcaacccgaacgtgacggcggatatcacccgccacgtactcttgttaagc
cgctggaaagccaccgatctgttcctgaaagacattcatgttctggtatcagaactgtcg
atggtcgacgccacgccggagctgctggcgttagtgggcgaagaaggcgcgtctgagccg
tatcgctacctgatgaaaaaattacgcgcccgtctgatggcgacccagtcctggctggaa
gcgcgtctgaaaggcgagaagctgcccaaaccggctggcctgctgacgcaaaacgagcag
ctctgggaacctctgtacgcctgctaccagtcgttacaggcctgcggtatgggcattatc
gccaacggcgagttactcgacacgctccgccgcgtgaagtgtttcggcgtaccgctggtg
cgcattgatatccgtcaggagagcacccgccataccgaagcgctgggcgaaattacccgc
taccttggtattggcgactacgaaagctggtcggaagccgacaagcaggccttcctgatc
cgcgagctgaactccaaacgtccgctgctgccgcgtaactgggagccgagcaacgatacc
cgcgaagtgcttgaaacctgcaaggttattgccgaagcaccaaaggggtcgatcgccgcc
tacgtgatttcaatggcgaaaacgccgtctgatgtgctggctgtgcatctgctgctgaaa
gaggcaggtatcggctttgccatgccggtcgcgccgctgtttgaaaccctcgacgacctg
aacaacgccgacgacgtgatgacccagttgttgaatatcgactggtatcgcgggctgatt
cagggtaagcagatggtcatgatcggctactccgactcggcgaaagacgccggcgttatg
gccgcgtcatgggcgcagtatcaggcgcaggacgccctgatcaaaacttgtgaaaaagct
ggcatcgagctcaccctcttccacggccgcggcggctctattggccgtggcggcgcgcca
gcccacgcggcgctgctttcgcaaccgccaggcagtctgaaaggcggcctgcgcgtgacc
gagcagggcgagatgatccgcttcaaatacggcctgccggaagtcaccgtcagcagcctg
tcgctctacaccagcgcaattctggaagcaaacctgctgccgccgccggaaccgaaagac
agctggcgtcatattatggatgagctttccgtcatctcctgtgaaacctaccgcggttac
gtgcgcgaaaataaagactttgtaccgtacttccgctccgcgacgccggaacaagagctg
ggcaaattgccgctcggctcacgtccggcgaaacgtcgtccaactggcggcgtcgaatcg
ctgcgcgcgattccgtggatcttcgcctggacgcaaaaccgcctgatgctgccagcctgg
ctgggcgcgggtactgcgctgcaaaaagtggtggaagacggtaaacaaagcgaactggaa
gccatgtgccgcgactggccgttcttctccacgcgtcttgggatgctggaaatggtattc
tcgaaagccgacctgtggctggccgactattacgatcagcgtctggtggcgaaaacgcta
tggccgctgggcaaagagctacgagacctgctggaagaagacattaaagtggtgctagcg
attgccaacgattcgcacctgatggccgacttaccgtggattgcggagtccattcagtta
agaaacgtttataccgatccattaaacgtgttgcaggccgagttgctgtatcgttcccgt
ctgactgaagagcagggcaaatcgcccgatcctcgcgtcgaacaggcgttgatggtcacg
attgcgggcgtcgccgccggtatgcgcaacaccggctaa

DBGET integrated database retrieval system