KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_1920Help
Entry
STM474_1920       CDS       T01760                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00010  Glycolysis / Gluconeogenesis
seb00230  Purine metabolism
seb00620  Pyruvate metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01200  Carbon metabolism
seb01230  Biosynthesis of amino acids
Module
seb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seb_M00002  Glycolysis, core module involving three-carbon compounds
seb_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
seb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM474_1920 (pykA)
   00620 Pyruvate metabolism
    STM474_1920 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    STM474_1920 (pykA)
Enzymes [BR:seb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     STM474_1920 (pykA)
Membrane trafficking [BR:seb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STM474_1920 (pykA)
Exosome [BR:seb04147]
 Exosomal proteins
  Proteins found in most exosomes
   STM474_1920 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-ProteinID: ADX17602
UniProt: E8X9F5
LinkDB All DBs
Position
1940045..1941487
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIQTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCDQNAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSAADGVVAAHEAVNLLRDKGYLVSGDLVIVTQGDVMSTVGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaaccaaaatcgttaccacgttaggcccggcaactgaccgc
gataacaaccttgagaaggttatcgccgcgggcgcaaacgtagtacgtatgaacttctct
cacggctcgccggaagatcataaaatgcgtgctgataaagtccgtgagattgccgccaaa
ctggggcgtcatgtggctattttaggcgacctgcaagggccaaaaattcgcgtttccact
tttaaagaaggcaaagtgttcctcaacatcggggacaaatttctgttagacgctaacctg
ggtaaaggcgaaggcgacaaagaaaaagtcggcattgattacaaagggttgccggcagac
gtcgttcctggcgatatcctgctgcttgacgatggtcgagtgcagttgaaagtgcttgaa
gtccagggcatgaaagtctttaccgaggtcaccgtcggcggcccgctgtctaacaataaa
ggcattaacaagctcggcggcgggctttctgctgaagcgctgaccgaaaaagacaaagcc
gatattcaaaccgctgcgctgataggtgttgactatctggccgtctccttcccgcgctgc
ggcgaagatctgaactatgcacgccgcctggcgcgcgacgccggctgcgacgcgaaaatt
gtggctaaggtcgaacgcgccgaagcggtatgcgaccaaaacgccatggacgatatcatt
ctggcctctgacgttgtgatggtcgcacgtggcgatctgggcgttgaaatcggcgatccg
gagctggttggtatccagaaagcgctgattcgccgtgcgcgtcagctaaaccgcgcagtc
atcaccgcaacgcaaatgatggagtcgatgatcaccaacccgatgccgacccgtgcggaa
gtgatggacgtggcgaacgccgtcctggatggcacggatgcggttatgctgtctgccgaa
accgcagccggtcagtatccttctgaaaccgttgccgcaatggcgcgcgtctgcctgggc
gcagaaaaaatccccagcatcaatgtgtctaaacaccgtctcgacgtgcagttcgacaac
gttgaagaagccattgccatgtctgcgatgtatgcggcaaaccatctgaaaggcgttacc
gcgatcatcaccatgacggaatccggtcgtaccgcgctaatgacttcccgtatcagctcc
ggcctgccgattttcgccatgtcgcgccatgaacgcacgctgaacctgaccgcgctctat
cgcggagtaacgccggtgcattttgatagcgcggctgatggcgttgtcgcggcacatgaa
gctgttaatctgctgcgcgataaagggtatctggtttccggcgacctggttatcgtgacc
cagggcgatgtcatgagcaccgtcggttcaaccaataccacgcgtattttgaccgttgag
taa

DBGET integrated database retrieval system