KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_2437Help
Entry
STM474_2437       CDS       T01760                                 

Definition
(GenBank) putative transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00030  Pentose phosphate pathway
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01200  Carbon metabolism
seb01230  Biosynthesis of amino acids
Module
seb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
seb_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STM474_2437
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    STM474_2437
Enzymes [BR:seb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     STM474_2437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADX18101
UniProt: E8XEZ3
LinkDB All DBs
Position
complement(2450865..2451818)
Genome map
AA seq 317 aa AA seqDB search
MIKLAPAGLKDDIEMRKVYAGFIAGQIEAGSPIIALEADLMSSMAMDSVARDYPQHVINC
GIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDYQRNNVKVIASDAGVTA
CHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFADILRQLMDLDGFYWLRTIRKQARSIY
APGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQEGVSAAVIDMFTLKPIDRM
LVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMRRVGVKERYGQVGTQDFLQK
EYGLTAEAIVEAAKSLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcttgcgcccgcagggcttaaagacgatatcgaaatgcgcaaagtttacgcc
ggttttatcgccgggcagattgaggccggaagcccaattattgcgcttgaggctgattta
atgagctcaatggcgatggacagcgtggcgcgtgactacccgcagcatgtcattaactgc
ggtattatggaggcgaatgtgattggcacggcggcggggctggcgctgaccggtcgtaaa
ccgtttgtgcatacctttaccgcttttgccagccgtcgctgttttgatcagctctttatg
gcgctggattatcagcgtaacaacgtcaaagtgatcgcctccgatgccggagtgacagcg
tgccataacggcggcacccatatgtcttttgaagatatggggattgttcgcgggctggcg
cactccgtagtactggaggtgacggatgcggtgatgttcgcggatattttacgccagcta
atggacctggacggtttttactggctgcgtaccatccgtaagcaggcgcggagtatctat
gcgccaggctctacctttaccattggcaagggcaacgtactgcgcgagggcgatgatatt
acgcttatcgccaacggcattatggtggcggaggcgctggaggcggcgcgccaactggag
caggaaggtgtgagcgccgcggtcattgatatgttcaccttaaagcctatcgatcgcatg
ttggtgaaaaactacgcggaaaaaacgcggcgtatcgtcacgtgtgaaaaccacagcatc
cataatggactggggtcagcggtggcggaagtgctggtggaaaactgtccggtgccgatg
cgccgtgttggcgtcaaagagcgttatgggcaggtaggaacgcaggatttcttacaaaaa
gagtacggactcaccgccgaagcgattgtagaagccgcgaaatcactgctttaa

DBGET integrated database retrieval system