KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_2754Help
Entry
STM474_2754       CDS       T01760                                 

Gene name
nadB
Definition
(GenBank) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00250  Alanine, aspartate and glutamate metabolism
seb00760  Nicotinate and nicotinamide metabolism
seb01100  Metabolic pathways
Module
seb_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STM474_2754 (nadB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STM474_2754 (nadB)
Enzymes [BR:seb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     STM474_2754 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like FAD_binding_3 Lycopene_cycl NAD_binding_8 GMC_oxred_N Pyr_redox_3 GIDA Retrotrans_gag
Motif
Other DBs
NCBI-ProteinID: ADX18409
UniProt: E8XIB3
LinkDB All DBs
Structure
PDB: 

Position
2780841..2782463
Genome map
AA seq 540 aa AA seqDB search
MMTTPELSCDVLIIGSGAAGLSLALRLAEKHKVIVLSKGPVSEGSTFYAQGGIAAVFDET
DSIASHVEDTLIAGAGICDRHAVEFVASNARTCVQWLIDQGVLFDTHVQPNGKESYHLTR
EGGHSHRRILHAADATGKEVETTLVSRAQNHPNIQVLERSNAVDLIISDKMGLPGPRRVV
GAWIWNRNKEWVETCHAKSVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEF
NQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGSRFMPDVDERGELAPRDIVARAIDHE
MKQLGADCMFLDISHKPDDFVRQHFPMIYAKLLDLGMDLTKEPIPVVPAAHYTCGGVVVD
DYGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAMDIDRRMPSVHSVDALP
AWDESRVENADERVVIQHNWHELRLLMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAN
FRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPQQLAESGPSILSPLTPHINR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaactcctgaactgtcctgtgatgtgttaattatcggcagcggcgcggccgga
ctctcgctggcgctgcgtctggctgaaaagcataaggttatcgtcctgagtaaagggccg
gtgagcgagggctccacgttttatgcgcagggcggtattgccgccgtgtttgatgaaacc
gacagtattgcgtcgcatgtcgaagatacgctgattgccggcgccggaatttgcgatcgc
cacgcggtggagtttgtcgccagcaacgcccgtacctgcgtgcagtggcttatcgatcag
ggcgtcctgtttgatacgcatgtccagccaaacggcaaggagagctatcatctcacgcgt
gaaggcggccatagtcatcgccgtatccttcatgccgccgacgctaccggaaaggaagtc
gaaaccacgttggtcagtcgggcgcaaaatcatcctaatattcaggtgctggaacgcagc
aacgccgttgatttaattatctccgataaaatgggtctgccggggcctcgccgggtcgtc
ggcgcctggatctggaatcgcaataaagagtgggttgaaacctgtcatgcgaagtcggtg
gtgctggcgaccggcggcgcctcaaaggtttatcaatataccactaacccggatatttcc
tccggtgacggtatcgcgatggcctggcgcgcaggctgtcgggtcgctaatctggaattt
aaccagtttcatcccaccgccctttatcacccgcaggcgcgtaattttctccttaccgaa
gcgctgcgtggcgaaggcgcataccttaaacgtccggacggttcacggtttatgccggac
gttgacgaacgcggggaactggcgccgcgcgatattgtcgcccgcgctattgaccatgag
atgaaacaactcggcgcagactgtatgtttctcgatatcagccacaagcctgacgatttt
gtccgccagcacttcccgatgatctatgcgaaactgcttgatttggggatggatttaacc
aaagaaccgattcccgttgttcctgccgcacactatacctgcggcggcgtggtcgtcgat
gattatggtcgtaccgatgtagacggcttatatgccattggcgaagtcagttacaccggc
ctgcacggcgctaaccgtatggcgtccaactcgttgctggaatgcttagtgtacggctgg
tccgcagcaatggatatcgacaggcgaatgccttctgtccacagcgttgacgcccttccc
gcctgggatgaaagccgcgtggaaaacgccgatgagcgggtggtgattcagcataactgg
catgaactgcgcctgctgatgtgggactatgtgggcattgtgcgcacgacgaaacggctg
gagcgcgccctacggcgtattaccatgttgcaacaagagattgacgaatattacgccaac
tttcgcgtctcgaataatttactggagctgcgcaatctggtgcaagtggccgaactgatt
gtgcgttgtgcgatgatgcgtaaagagagtcgggggctgcactttacgctggattatccg
caacaactggctgaatcaggcccatcgatcctttcgccgttaacgcctcacataaataga
taa

DBGET integrated database retrieval system