KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3389Help
Entry
STM474_3389       CDS       T01760                                 

Gene name
yhaJ
Definition
(GenBank) putative transcriptional regulator
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_20
Motif
Other DBs
NCBI-ProteinID: ADX19025
UniProt: E8XBG3
LinkDB All DBs
Position
complement(3420717..3421613)
Genome map
AA seq 298 aa AA seqDB search
MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKLEEELDVVLFDRSGHR
TKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHLTLVTEALVPTPAFFPLIDRLA
AKANTQLSLITEVLAGAWERLEQGRADIVIAPDMHFRSSSEINSRKLYTLMNVYVAAPDH
PIHQEPEPLSEVTRVKYRGVAVADTARERPVLTVQLLDKQPRLTVSTIEDKRQALLAGLG
VATMPYSMVEQDIAEGRLRVVSPESTSEIDIIMAWRRDSMGEAKAWCLREIPKLFAGK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagagagcgctgacgcttgaagcattgcgtgtgatggacgccattgaccgc
cggggcagttttgccgcagcggctgatgagttggggcgtgtgccctccgcgctgagttac
accatgcagaagctggaagaagagttggacgttgtactgttcgatcgctccggccatcgt
acaaaattcaccaacgtcggacgtatgctgctggaacgcgggcgggtattgctggaagcg
gcagacaagttaacgacggatgctgaagcgttggcccgcggttgggaaacgcatctgacg
ctagtcactgaagctctggtaccgacgcctgctttttttccactgatcgaccggctggcc
gctaaagccaatacgcagctttcattgattaccgaagtactggctggcgcatgggagcgg
cttgagcagggacgggcggatatcgttatcgctccggatatgcattttcgatcgtcgtcg
gaaattaactcccgtaagttgtatacgttaatgaatgtgtatgtcgccgcgcctgaccac
cctattcatcaggagccggagccgctttcggaagtgacgcgggttaaataccgcggcgta
gcggtagcggataccgcgcgcgagcggccggtattaacggtgcaactgctggataagcag
ccacgtctgacggtaagcacgattgaagataaacgtcaggcgctgctggccgggcttggc
gtcgcgaccatgccatattcgatggtggaacaggatattgccgaagggcggctacgcgtg
gtcagcccggaatcgaccagcgaaatcgatattattatggcctggcggcgcgacagtatg
ggggaggcaaaagcctggtgcctgcgggaaatacctaagctattcgccggaaaataa

DBGET integrated database retrieval system