KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3653Help
Entry
STM474_3653       CDS       T01760                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01130  Biosynthesis of antibiotics
seb01230  Biosynthesis of amino acids
Module
seb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STM474_3653 (aroB)
Enzymes [BR:seb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     STM474_3653 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADX19275
UniProt: E8XEI9
LinkDB All DBs
Position
complement(3662601..3663689)
Genome map
AA seq 362 aa AA seqDB search
MERITVTLGERSYPITIAAGLFNEPASFLPLKSGDQVMLVTNETLAPLYLDKVRGVLERA
GVNVDSVILPDGEQYKSLTVLDTVFTALLKKPHGRDTTLVALGGGVIGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPARELTS
GLAEVIKYGIILDADFFTWLEGNLDALLRLDGPAMAYCIRRCCELKAEVVAADEREAGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGIVMAARASERLGQFSSADTQRIIALLERA
GLPVNGPCEMSAQDYLPHMLRDKKVLAGELRLVLPLAIGKSEVRGGVSHEVVLSAIADCQ
QA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaggattacagtcactctcggggaacgtagttacccgatcaccatcgcggctggt
ttgtttaacgaaccagcttcattcttgccgctgaaatcaggcgatcaggtcatgttagtg
accaacgaaaccctggcgccgctttatctggacaaggttcgcggcgtactcgaacgggcg
ggcgttaacgtagacagcgtgattcttcctgacggcgagcagtataagagcctgacggtg
ctggatacggtgtttacggcgttactgaaaaaaccgcatggtcgtgataccacgctggtc
gcgcttggcggcggcgtgattggcgatctcaccggttttgcggcggccagctaccagcga
ggcgttcgtttcatccaggtgccaactaccttactgtcgcaggttgattcttccgtgggc
gggaagaccgccgtcaaccatccccttggcaaaaacatgattggcgcgttttaccaaccc
gcttctgtggttgtcgatcttgattgcctgaaaacgcttcccgcacgcgaactgacatcg
ggactggcagaggtgatcaaatacggcattatactcgacgcggacttcttcacctggctt
gaaggtaatctggatgcgctattgcgtctggacggcccggcgatggcgtactgtattcgt
cgttgttgcgagctgaaagccgaagttgttgccgccgacgagcgtgaagcgggcttacgt
gctttactgaatcttggacatacctttggccacgccattgaagcggaaatgggatatggc
aattggttacatggtgaagccgttgccgcaggtatagtgatggctgcacgcgcatccgag
cgtttagggcagttcagttctgctgatacgcagcgcatcatcgctctactcgaacgggcc
gggttgccagtcaatggcccttgcgagatgtccgcgcaggactatttgccgcacatgctg
cgagataaaaaagtgttagcgggggagctgcgtttagtgcttccgctggccatagggaaa
agtgaagtgcgcggcggagtgtcgcacgaagtcgttcttagcgcgattgctgactgtcag
caggcgtga

DBGET integrated database retrieval system