KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3654Help
Entry
STM474_3654       CDS       T01760                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01130  Biosynthesis of antibiotics
seb01230  Biosynthesis of amino acids
Module
seb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STM474_3654 (aroK)
Enzymes [BR:seb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     STM474_3654 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase TsaE AAA_22 ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase His_biosynth PduV-EutP Mg_chelatase AAA_2 AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: ADX19276
UniProt: E8XEJ0
LinkDB All DBs
Position
complement(3663746..3664267)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
NREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgttgaaggtgaagacggcttccgt
aatcgtgaagaaaaagttatcaacgaattgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcgcgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtctaccttgaaacgaccatcgaaaaacaactggcgcgcacgcagcgtgataaaaaacgc
ccgctgttgcaggttgaagcaccgcctcgcgaagttctggaagcgctggctaacgaacgc
aatccgctgtacgaagagattgccgacgtcaccattcgcaccgacgatcaaagcgctaag
gttgtggcaaaccagattattcatatgctggaaagcaactaa

DBGET integrated database retrieval system