KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3836Help
Entry
STM474_3836       CDS       T01760                                 

Gene name
malS
Definition
(GenBank) periplasmic alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00500  Starch and sucrose metabolism
seb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STM474_3836 (malS)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STM474_3836 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADX19454
UniProt: E8XFX8
LinkDB All DBs
Position
3871847..3873874
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAP
APFNWRNATVYFVLTDRFRNGDPTNDHSYSRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPAAGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
REWKQANPDKALDNSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMTDKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcgacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccaaatgttgtcgttaaaaccctgcgaaggcgcgccgccg
caatggcgtttgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgaacgcaccgcgcagctcgcctaccag
tgtcccgtctgggatgggtcgccgctcacgctggatgttcgccaaacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcgccg
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaacgaccacagctatagtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttgcgcgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
gggacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcagcgaagccgatctccgcgcgctggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagttcggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgacccgccgccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggtctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgagggctatacgccacgggattatctg
actcactggttaagccagtgggtacatgattacggcattgacgggttccgggtcgatact
gccaaaaacgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
cgtgaatggaagcaggccaatccggacaaagcgctggataatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatgacggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccaggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

DBGET integrated database retrieval system