KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4540Help
Entry
STM474_4540       CDS       T01760                                 

Gene name
frdA
Definition
(GenBank) fumarate reductase flavoprotein subunit
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00020  Citrate cycle (TCA cycle)
seb00190  Oxidative phosphorylation
seb00620  Pyruvate metabolism
seb00650  Butanoate metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01200  Carbon metabolism
seb02020  Two-component system
Module
seb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seb_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STM474_4540 (frdA)
   00620 Pyruvate metabolism
    STM474_4540 (frdA)
   00650 Butanoate metabolism
    STM474_4540 (frdA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STM474_4540 (frdA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STM474_4540 (frdA)
Enzymes [BR:seb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     STM474_4540 (frdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like GIDA GFO_IDH_MocA Myb_DNA-bind_4 Lycopene_cycl DAO
Motif
Other DBs
NCBI-ProteinID: ADX20114
UniProt: E8XAM2
LinkDB All DBs
Position
complement(4604564..4606438)
Genome map
AA seq 624 aa AA seqDB search
METHSYFAEPRGFIWLREGEITIIWRNVVQTFQADLAIIGAGGAGLRAAIAAAQANPNAK
IALISKVYPMRSHTVAAEGGSAAVAQDHDSFDYHFHDTVAGGDWLCEQDVVDYFVHHCPT
EMTQLEQWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQR
FDEHFVLDILVDDNHARGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGD
GMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPE
TPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVHLDLRHLGEKKLHERLPFI
CELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCESRVKGLFAVGECSSVGLHGANRL
GSNSLAELVVFGRLAGEQAMERAATAGAANSAALDAQVADIEQRLKNLVNQEGNENWSKI
RDEMGLSMEEGCGIYRTPELMQKTVDKLAELQERFKRVRISDTSSVFNTDLLYTIELGHG
LNVAECMAHSALARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT
TLPPAKRVYGGEAEAADKKEKANG
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacgcattcatacttcgcagaacccagaggctttatctggctgcgcgagggtgaa
attacaataatctggaggaatgtcgtgcaaacctttcaagccgatcttgccattataggc
gccggtggcgcgggattacgtgctgcaattgctgccgcacaggcgaatcccaatgctaaa
atcgcactgatctcaaaagtgtacccgatgcgcagccacaccgtcgctgccgaagggggt
tcagccgctgtcgcccaggatcatgacagctttgactaccattttcacgatacggtagca
ggcggagactggctgtgtgagcaggatgtcgtggattactttgtccaccattgtcccact
gagatgacgcagctggagcaatggggctgcccgtggagccgccgtccggacggtagcgtt
aacgtgcgtcgcttcggtggtatgaaaatcgagcgtacctggttcgccgcggataaaacc
ggcttccatatgctgcataccctgttccagacttccctgcagttcccacaaatccagcgc
tttgacgaacatttcgtgctggatattctggttgatgacaaccatgcgcgcggcctggtg
gcaatgaacatgatggaaggcacgctggtgcaaatccgtgccaacgccgtggtcatggcg
acaggcggcgcaggccgcgtataccgctataacaccaacggcggcatcgtcaccggcgac
gggatgggcatggcgctgagccatggcgttccgctgcgtgatatggaattcgttcagtat
cacccgaccggcctgccaggttccggtatcctgatgactgaaggttgccgcggcgaaggc
ggtattctggtcaataaaaatggctatcgttacctgcaagactacggcatgggccccgaa
acgccgctgggcgagccgaaaaacaaatatatggaactggggccacgtgacaaagtatcc
caggctttctggcacgaatggcgtaaaggcaacaccatctccacgccgcgcggcgatgtg
gttcacctcgacctgcgtcatctcggcgagaagaaactgcatgaacgtctgccgttcatt
tgcgaactggcgaaagcctatgtcggcgtcgatccggttaaagaaccgattccagtacgt
ccgaccgcgcactacaccatgggcggcattgaaaccgaccagaactgtgaaagccgtgtc
aaagggctgtttgccgttggcgaatgctcctctgttggcctgcatggcgcgaaccgcctc
ggttccaactcactggcggaactggtggtgtttggtcgtctggctggcgaacaagcaatg
gaacgcgctgctacggcaggcgccgcaaatagcgccgcgctcgacgcccaggttgccgat
attgaacagcgtctgaaaaatctggtgaaccaggaaggcaacgaaaactggtcgaagatc
cgcgatgagatgggtctgtctatggaagaaggttgcggtatttaccgtaccccggaactg
atgcagaaaaccgttgataaactggccgagcttcaggaacgtttcaagcgcgtacgtatc
tccgatacctccagcgtgttcaacactgacctgctgtataccatcgaactgggtcatggt
ctgaacgtggcggaatgtatggcgcactctgcgctggcgcgtaaagagtcccgcggcgcg
catcagcgtctggatgaaggctgtaccgagcgcgacgatgtgaacttcctcaagcacacc
ctcgccttccgcgatgctgatggcacgacccgtctggaatacagcgacgtgaaaatcacc
accctgccgccagccaaacgtgtttacggcggtgaagcggaagcagccgataagaaggag
aaggcgaatggctga

DBGET integrated database retrieval system