KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_0268
Entry
SCH_0268          CDS       T00240                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K11901  type VI secretion system protein ImpB
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Brite
KEGG Orthology (KO) [BR:sec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sec02044]
    SCH_0268
Secretion system [BR:sec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SCH_0268
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAX64174
UniProt: Q57SY7
LinkDB
Position
309841..310383
AA seq 180 aa
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggctctgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcacccaactggcgaacctccagacctacatggatggtaaggcc
ggggcggaaaatctggtcaataaactgttgcaggacccgaccctgctgaaaacgctagcg
aatgcgccgaaaccggccgctacccagcaaggtgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system