KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_0770Help
Entry
SCH_0770          CDS       T00240                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00010  Glycolysis / Gluconeogenesis
sec00260  Glycine, serine and threonine metabolism
sec00680  Methane metabolism
sec01100  Metabolic pathways
sec01110  Biosynthesis of secondary metabolites
sec01120  Microbial metabolism in diverse environments
sec01130  Biosynthesis of antibiotics
sec01200  Carbon metabolism
sec01230  Biosynthesis of amino acids
Module
sec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sec_M00002  Glycolysis, core module involving three-carbon compounds
sec_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCH_0770 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SCH_0770 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCH_0770 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sec04131]
    SCH_0770 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sec04147]
    SCH_0770 (gpmA)
Enzymes [BR:sec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCH_0770 (gpmA)
Membrane trafficking [BR:sec04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCH_0770 (gpmA)
Exosome [BR:sec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCH_0770 (gpmA)
  Exosomal proteins of melanoma cells
   SCH_0770 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAX64676
UniProt: Q57RI5
LinkDB All DBs
Position
complement(865001..865753)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaacgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggccgaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtaacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgaattaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggtaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system