KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_2341Help
Entry
SCH_2341          CDS       T00240                                 

Gene name
tktC
Definition
(GenBank) putative transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00030  Pentose phosphate pathway
sec01100  Metabolic pathways
sec01110  Biosynthesis of secondary metabolites
sec01120  Microbial metabolism in diverse environments
sec01130  Biosynthesis of antibiotics
sec01200  Carbon metabolism
sec01230  Biosynthesis of amino acids
Module
sec_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sec_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCH_2341 (tktC)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SCH_2341 (tktC)
Enzymes [BR:sec01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SCH_2341 (tktC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Motif
Other DBs
NCBI-ProteinID: AAX66247
UniProt: Q57M15
LinkDB All DBs
Position
complement(2467560..2468513)
Genome map
AA seq 317 aa AA seqDB search
MIKLAPAGLKDDIEMRKVYAGFVAGQIEAGSPIIALEADLMSSMAMDSVARDYPQHVINC
GIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDYQRNNVKVIASDAGVTA
CHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFADILRQLMDLDGFYWLRTIRKQATSIY
APGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQEGVSAAVIDMFTLKPIDRM
LVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMRRVGVKERYGQVGTQDFLQQ
EYGLTAEAIVEAAKSLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcttgcgcccgcagggcttaaagacgatatcgaaatgcgcaaagtttacgcc
ggttttgtcgccgggcagattgaggccggaagcccaattattgcgcttgaggctgattta
atgagctcaatggcgatggacagcgtggcgcgtgactacccgcagcatgtcattaactgc
ggtattatggaggcgaatgtgattggcactgcggcggggctggcgctgaccggtcgcaaa
ccgtttgtgcatacttttaccgcttttgccagccgtcgctgttttgatcagctcttcatg
gcgctggattatcagcgtaacaacgtcaaagtgatcgcctccgatgccggagtgacggcg
tgccataacggcggcacccatatgtcttttgaagatatggggattgttcgcgggctggcg
cactccgtagtactggaggtgacggatgcggtgatgttcgcggatattttacgccagcta
atggatctggacggtttttactggctgcgtaccatccgtaagcaggcgacgagtatctat
gcgccaggctctacctttaccattggcaagggcaacgtactgcgcgagggcgatgatatt
acgcttatcgccaacggcattatggtggcggaggcgctggaggcggcgcgccaactggag
caggaaggcgtgagcgccgcggtcattgatatgttcaccttaaagcctatcgatcgcatg
ttggtgaaaaactacgcggaaaaaacgcggcgtatcgtcacgtgtgaaaaccacagcatc
cataatggactggggtcagcggtggcggaagtgctggtggaaaactgcccggtgccgatg
cgccgtgttggcgtcaaagagcgttatgggcaggtaggaacgcaggatttcttacaacaa
gagtacggactcactgccgaagcgattgtagaagccgcgaaatcactgctttaa

DBGET integrated database retrieval system