KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_3529Help
Entry
SCH_3529          CDS       T00240                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00040  Pentose and glucuronate interconversions
sec00051  Fructose and mannose metabolism
sec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCH_3529
   00051 Fructose and mannose metabolism
    SCH_3529
Enzymes [BR:sec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SCH_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAX67435
UniProt: Q57IM7
LinkDB All DBs
Position
complement(3725471..3726424)
Genome map
AA seq 317 aa AA seqDB search
MKFSSRINSFRSRPELFNADNKMDTCDLITRMGNVDGLTHIELNYPDHFIGQDKKIIKQC
ITDNGLKVSGIALRYNKDFIDGEFTNPDSVLRDKAIETTLEAAEVCKFLGGTTVTLWFGY
DGYDYPFQQDYFRAYELLVNALRKVTSAHPDLQFSFEYKPYEPRTFSYISDVSSTLMLID
DVGNDNLGITLDFCHMIMKKENPAFSLFQSARKNRLVGFHLNDGYGHFDDGLMLGSVHLL
QTLEYIYYAKRVNFNGLIYFDTFPSREDPVAECALNIRMYKALSDFIDQLSIPEIEAMIK
SQDALKVQGMLLSMIAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcttcgcgaattaattctttccgctcaagacctgaattatttaatgcagat
aataagatggatacatgtgatcttattacaagaatgggcaatgtagatggattgacgcat
atagagctaaactatcctgatcattttattggacaggataaaaaaatcattaaacaatgt
attacagataacggattgaaagttagcggcattgcactacgttacaataaagattttatt
gatggtgaatttactaacccagattcggttcttcgcgataaagcgattgagacaacgttg
gaagctgctgaagtttgtaagttcctggggggcactactgtaacattatggtttggctat
gacggttatgattacccatttcaacaagactattttcgagcgtatgaattgctggtaaat
gccttacgtaaggtgacaagtgctcatccagatcttcagtttagttttgaatacaagcct
tatgaaccacggaccttttcttatattagtgatgtttcctcaaccctaatgttaattgat
gatgtcggtaacgataacttggggattacacttgatttctgccatatgataatgaaaaag
gaaaacccagcattttcattattccagtcagcacgtaaaaatagacttgtaggcttccat
ttaaatgatggatatggtcatttcgatgatggtttaatgttaggttcagtccatctgtta
cagactcttgaatatatttactatgctaaacgcgttaatttcaatggattgatttatttt
gatactttccctagccgcgaggatccagttgcagaatgtgcgctgaatattcgaatgtat
aaagcactttcagactttatagatcaactcagtattcctgagatagaagcgatgatcaaa
agccaggatgcactaaaagtacagggtatgttgttaagcatgatagccaaataa

DBGET integrated database retrieval system