KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2059Help
Entry
SeD_A2059         CDS       T00757                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: ACH76136
LinkDB All DBs
Position
complement(1991800..1992843)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMTIIAADIPVPKENEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGNRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATNIAVVDVLEKRLAMAERLGATTVINGAKEDTVALCQQFTDDMGADI
VFETAGSAVTTQQAPYLVMRGGKIMIVGTVAGDSAINFLKINREVSIQTVFRYANRYPVT
IDAISSGRFDVKSMVTHIYDYKDVQRAFEESVNNKRDIIKGVIKVCD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatactaaaaacgccgggcaccatgacaattatagcggctgat
attccagtaccaaaagaaaacgaagtattgatcaaagtggaatatgtcggtatttgcggt
tcagatgttcacggttttgaatccgggccattcattccgccgaaggatccaaatcaggaa
attggtctcggtcatgagtgtgctggtacggtcgttgcggtcggcaatcgggtaagcaaa
tttaagccaggcgatcgggttaatatcgagccgggcgtgccgtgcggccactgccgctat
tgtctggaaggaaaatacaatatttgtccggatgttgattttatggcgacgcagccgaat
tatcgcggggccttaacgcactatctgtgccatccggaaagttttacgtacaagcttccg
gacaatatggacactatggaaggtgcgctggtggaacctgctgctgttggaatgcacgcg
gcaatgctggcggatgttaaaccgggtaagaaaatcgtcattctcggcgcgggctgcatt
ggtttaatgaccctgcaagcgtgtaagtgtctgggggcgaccaatatcgcggtagtggat
gtgctggaaaaacggctggcaatggctgaacgactgggcgcgacaaccgttatcaatggg
gcgaaagaagatactgtcgcgctctgccagcagttcaccgacgatatgggcgccgatatt
gtgtttgaaaccgccggttccgccgtcacaactcagcaagcgccgtatctggtcatgcgc
ggcgggaagatcatgattgttggcactgtcgcaggagattcagcgattaatttcctcaaa
attaaccgtgaagtctccatccagacggtattccgctatgccaaccgctatccggtgact
attgatgccatctcctccgggcgtttcgatgtgaaatcaatggtgacgcatatttacgat
tacaaagacgtacaacgtgcatttgaagagtcggtgaataacaaacgcgacattattaaa
ggcgttattaaagtttgcgattaa

DBGET integrated database retrieval system