KEGG   Sedimentitalea sp. W43: EBB79_12130Help
Entry
EBB79_12130       CDS       T05780                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sedi  Sedimentitalea sp. W43
Pathway
sedi00010  Glycolysis / Gluconeogenesis
sedi00020  Citrate cycle (TCA cycle)
sedi00620  Pyruvate metabolism
sedi01100  Metabolic pathways
sedi01110  Biosynthesis of secondary metabolites
sedi01120  Microbial metabolism in diverse environments
sedi01130  Biosynthesis of antibiotics
sedi01200  Carbon metabolism
Module
sedi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sedi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBB79_12130
   00020 Citrate cycle (TCA cycle)
    EBB79_12130
   00620 Pyruvate metabolism
    EBB79_12130
Enzymes [BR:sedi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EBB79_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: AZV78550
UniProt: A0A3T0N3E9
LinkDB All DBs
Position
2480761..2482065
Genome map
AA seq 434 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVIGKIL
IAEGSEGVKVNTAIAVLLEDGESAGDISSSAAPAATAAAVNEAAPAASEAAAPASSAPAA
PAAADGSRVFASPLARRIAADKGLDLAALQGSGPRGRVVKADVINATAAPKAAAPAAAAT
VSAPAAAAAPTGMSADIVAKMYADRDYDEVTLDGMRKTIAARLTEAKQTIPHFYLRRDIQ
LDALLAFRAQLNAQLAGRGVKLSVNDFIIKAVAIALQQVPEANAVWAGDRVLQMKSSDVA
VAVAIEGGLFTPVLQDADMKSLSALSAQMKDMASRARERKLAPSEYQGGSFAISNLGMFG
IDNFDAIVNPPHAGILAVGAGKKQPVVGADGELKVATVMSVTMSVDHRVIDGAVGANLMK
AIVENLENPVAMLA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagaaatcctgatgcccgcgctgtcccccaccatggaggagggtaccctggcg
aaatggctggtcaaagagggcgacaccgtgtcctccggtgacctgatcgccgagatcgaa
accgacaaggccacgatggaattcgaagccgtcgacgaaggggtgattggcaaaatcctg
atcgccgagggctccgaaggggtgaaagtgaacaccgccatcgcagtgctgctggaagac
ggtgaaagcgccggtgacatctcatccagcgctgcgccagctgccactgcagccgcggtg
aacgaggcggcccctgctgcctccgaggccgccgcacctgcgtcatctgctccggcagcc
cccgcagcggcagacggcagccgtgtctttgcctcacctctggcccgtcgcatcgcggca
gacaaaggtctggatctggctgccttgcaaggctccggcccgcgtggtcgtgtcgtcaaa
gctgacgtgatcaacgcaaccgccgcccccaaggctgctgctcccgctgctgccgcgact
gtctctgcaccggctgctgccgctgcacctacgggcatgtcagccgatattgtggccaaa
atgtacgccgaccgcgactacgacgaggtcaccctcgacggcatgcgcaaaaccatcgcc
gcacgcctgactgaggccaagcagaccatcccgcacttctacctgcgtcgtgacattcag
ctggatgccctgctggccttccgcgctcaactgaacgcacagctcgcaggacgcggtgtg
aagctctcggtcaacgacttcatcatcaaggcggtcgccattgccctgcaacaggtcccc
gaggccaatgcagtctgggccggggatcgtgtcttgcagatgaaatcctcggatgtggcc
gttgccgttgccatcgagggcggcctgttcacaccagttctgcaagacgccgacatgaaa
tctctgtcggccttgtcagctcagatgaaagacatggcgtcgcgcgcgcgcgagcggaaa
ctggcgcccagcgaatatcagggcggctcctttgcgatctctaacctgggcatgttcggc
atcgacaatttcgacgccatcgtgaacccaccccacgccggtatcctggccgtgggtgct
ggcaagaagcagcctgttgtcggcgccgatggtgagctgaaagtggcaaccgtgatgtct
gttaccatgtcggtggaccaccgtgtcatcgatggggccgtgggcgcaaacctgatgaaa
gccattgttgagaacctggaaaatccagttgccatgctggcctaa

DBGET integrated database retrieval system