KEGG   Sedimenticola thiotaurini: AAY24_00955Help
Entry
AAY24_00955       CDS       T03943                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00250  Alanine, aspartate and glutamate metabolism
seds00650  Butanoate metabolism
seds01100  Metabolic pathways
seds01110  Biosynthesis of secondary metabolites
seds01120  Microbial metabolism in diverse environments
seds02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAY24_00955
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAY24_00955
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAY24_00955
   00430 Taurine and hypotaurine metabolism
    AAY24_00955
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAY24_00955
Enzymes [BR:seds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AAY24_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SHMT SepSecS
Motif
Other DBs
NCBI-ProteinID: AKH19148
UniProt: A0A0F7JX37
LinkDB All DBs
Position
complement(216932..218590)
Genome map
AA seq 552 aa AA seqDB search
MTPGKASDQKHAVANLSNLYRIFTVPESPDSTLGRIDQEISQNLNGFLRNHIVATEQDLT
IIEQGFSSPRIPEQPTFVSDYTEFLLDTLVAQSVHTAAPGFVGHMTSALPNFMLPLSRIM
TALNQNLVKIETSKAFTPMERQVLGMLHALIYGKDDAYYQHWMHDPECALGSFCSGGTLA
NITALWVARNNLFPADDGFQGIAKEGLYRAFRHYGCEGAVVLISQRGHYSFGKAADLLGI
GRDSIIAIPTDADNRIDIGELQATCDRLKEQGIRIISLVGIAGTTETGNVDPLDKLADIA
EQQGCHFHVDAAWGGPTLFSETYKPLLKGIERADSVTIDAHKQLYVPMGAGMVLFKNPAS
LSSIEHHAEYILRKGSKDLGSHTLEGSRPGTAMLVHSALNIIGRKGYELLIDKGIGIART
FAAMIDADADFELITEPELNLLTYRYVPAPLQALLPKLPAGELAAVNRELDALTMQIQKV
QRAAGQSFVSRTRLSRPQYDNDTITVFRVVLANPLTTPEILREMLAEQKQIATEDPEAAA
IVAGLLESVAED
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggtaaagcaagcgaccagaagcatgcggtcgccaatctgagtaacctgtat
cgaattttcaccgtccccgaatccccggactccaccctgggcaggattgatcaggagatc
tcccagaacctgaacggtttcctgcgcaatcatatcgttgccacggagcaggatctgaca
attatcgagcagggtttctcatcacccaggattccagagcagccgaccttcgtgtcggat
tataccgaattcctgctggatacgctggttgcccagtcggtacataccgcggcacctgga
tttgtcggccacatgacatcggccctgcccaatttcatgctgcccctgtcacgcatcatg
accgcgctgaaccagaatctggttaagatcgagacctcaaaggccttcacccccatggag
cggcaggtactggggatgctccatgccctgatctacggtaaagatgatgcctattaccag
cactggatgcacgacccggagtgcgccctgggctccttctgctccggtggcaccctggcc
aacatcaccgcgctctgggtggcccgaaacaacctgttcccggccgacgacggttttcag
ggcatcgccaaggagggactctaccgggccttccggcactacgggtgcgaaggggcggtg
gtactgatttcacaacgggggcactactccttcggtaaggcagccgacctgctggggatc
ggccgggattccattatcgctatccccaccgatgccgataaccggatcgatatcggggaa
ctccaagcgacctgcgaccggctgaaggaacagggcatcaggataatcagcctggtgggc
attgctggcaccaccgaaaccggtaatgtggatcccctggacaagttggcggatatcgcc
gagcagcagggttgtcacttccacgttgatgccgcctggggcggaccgaccctgttctcc
gagacctacaaaccgctgctgaaagggatcgaacgggccgactcggtcaccatcgatgcc
cacaagcagctctacgtgcctatgggcgccggcatggtgctgttcaagaacccggcctcc
ctctccagcatcgaacaccatgcggagtacatcctgcgcaagggctccaaggatctgggc
agccatacactggagggttcgcgcccgggtaccgccatgctggtccactcagccctgaat
attatcggccgcaagggttacgaactgctgattgacaagggaatcgggatagcccgtacc
ttcgctgccatgattgatgccgatgccgatttcgaactgatcaccgaaccggaactgaat
ctgctcacctaccgttatgtgccagccccgctgcaggcgctactgcccaaactgccggcc
ggcgaactcgctgcagtcaaccgggaactggatgccctgaccatgcagatccagaaagtc
caacgggcagccggccagagcttcgtctcccggacccggctgtcccggccgcaatacgat
aatgacaccatcaccgtattccgggtggtactggccaacccgctcaccacaccggagatc
ctgcgggagatgctggccgaacagaaacagattgcgacagaagacccggaggccgccgcg
atagtcgccggtttgctggagtcggttgccgaagactag

DBGET integrated database retrieval system