KEGG   Sedimenticola thiotaurini: AAY24_04095Help
Entry
AAY24_04095       CDS       T03943                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00480  Glutathione metabolism
seds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AAY24_04095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seds02000]
    AAY24_04095
Enzymes [BR:seds01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AAY24_04095
Transporters [BR:seds02000]
 Other transporters
  Pores ion channels [TC:1]
   AAY24_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: AKH19674
UniProt: A0A0F7JWE5
LinkDB All DBs
Position
complement(922076..922729)
Genome map
AA seq 217 aa AA seqDB search
MSLELVSFAICPFVQRAVIALKEKQVDFKITYIDLENPPAWFKEISPFGKVPLLRIDQEV
LFESAVINEYLDEVYSPRLHPDDPLVRAKHRGWIEFGSNLIFEQYKLMVATDDDGVQQQC
EALGGLFARLANEVSDGPYFMGDQFTLLDTAYAPFFTRYEILKKYHEELEELIPSRLAHW
GRSLLARDSVKASVADDFEQKFVDFGKSKGSFILARA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaactggtcagttttgctatctgtccgtttgtccagcgtgcagtgattgcg
ctgaaagagaaacaggtggatttcaaaatcacctatatcgatctggaaaatccaccggcg
tggtttaaagagatttcacccttcggtaaagtcccactgctcagaattgatcaggaggtg
ctgtttgagtctgcagtaatcaacgaatatctcgacgaagtttattcaccccgattgcat
ccggacgatcccctggttcgggctaaacaccggggctggattgagttcggttccaatctg
atctttgaacagtacaagttaatggtggccacggatgatgatggggtccagcagcagtgt
gaggcgctgggcggcctgttcgcccgcctggcgaacgaggtcagcgatggcccctatttc
atgggggatcaatttaccctgctggataccgcctatgcgccgttttttacccgctatgag
atcctgaaaaagtatcacgaggagttggaagagctgatcccttctcggctggcccattgg
ggacggtcgctgttggccagggattcggtcaaggcatcggtggccgatgactttgaacag
aaatttgtcgatttcggcaagagcaaaggctcctttattctggccagagcataa

DBGET integrated database retrieval system