KEGG   Sedimenticola thiotaurini: AAY24_06505Help
Entry
AAY24_06505       CDS       T03943                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00030  Pentose phosphate pathway
seds01100  Metabolic pathways
seds01120  Microbial metabolism in diverse environments
seds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AAY24_06505
Enzymes [BR:seds01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AAY24_06505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKH20063
UniProt: A0A0F7JZP6
LinkDB All DBs
Position
complement(1446580..1448430)
Genome map
AA seq 616 aa AA seqDB search
MGWQKKILRVNLTEGTCAPEPLNMAWAADYLGQRGLGSKYLAEEVDPKVDPLSPDNKLIF
ATGPLTGTASSTSARYSVITKGALTGAIACSNSGGYFGAELKFAGWDMIIFEGRAPKPVY
LYINDDHAELLPADEIWGKSVWDADKILHAKHQDPQLKISAIGRAGEEGVMFACIVNDLH
RAAGRSGVGTVMGSKNLKAVAVRGTKGVSVKDPVRFMETVAEKKKILAENPVTGQGLPTY
GTQVLMNVINEVGALPTNNASAVQFDGASKISGEAMHEPRASDGKANLVTNQACFGCTIA
CGRVARIDKEHYTVKNRPEYWGASGGLEYENAWSLGADCGVDDLDALTFANYICNEQGFD
PITFGATMAAAMELYEMGVITDEDTGGVKLNFGSAEALTTMAELVGKGEGFGKILGLGSK
RLCEKYGHPELSMSVKGQEFPAYDPRGIQGMGLTYATSNRGACHLRSYTVASEILGIPEK
TDPLVTEGKAGLVKAFQDATAAVDSSGLCVFTTFAWTLEDFYPQIDAACEGEWTLERLAE
TGERIWNLERQFNMAAGFTAKDDTLPKRLLTEPATTGPAAGKVSGLAKMLPEYYELRGWS
KEGVPTPDTLRGLGLS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggctggcagaaaaaaatattgcgtgtgaatttaacggaaggcacctgcgcccccgaa
cccctgaacatggcgtgggcggcggactatctcgggcagcggggcctgggttccaagtac
ctggcggaggaggtggatcccaaggtcgatcccctgtcaccggacaataagctgatcttc
gccaccggtcccctgaccggcaccgcctcatccaccagtgcgcgctactcggtcatcacc
aaaggggcgctcaccggcgccatcgcctgctccaactcaggcggctatttcggcgctgag
ttgaagtttgccggttgggacatgatcatttttgagggccgggcacccaaaccggtctat
ctctatatcaatgacgatcatgccgaactgctgccggcggatgagatctggggcaagagc
gtctgggatgcggacaagatcctgcacgccaagcaccaggacccgcagctgaagatctcc
gccatcggcagggccggcgaggagggcgtcatgttcgcctgcatcgtcaatgatctgcat
cgggccgccggtcgctccggcgtcggtaccgtgatgggttccaagaacctgaaggcggtg
gcggtgcggggcaccaagggggtcagtgtgaaggatcccgtgcgcttcatggagacggtg
gccgagaaaaagaagatcctggccgagaatccggtcaccggacagggcctgcccacctac
ggcacccaggtgctgatgaacgtgatcaacgaagtgggtgcgctgcccaccaataacgcc
tcggccgtgcagtttgatggcgcctcgaaaatctccggtgaggcgatgcatgaaccccgt
gccagcgacggcaaggccaacctggtgaccaaccaggcctgcttcggctgcaccatcgcc
tgcgggcgtgtcgcccgtatcgacaaagagcactacacggtgaaaaaccgtcccgagtac
tggggtgcttccggtggtctggagtacgagaacgcctggtccctgggtgccgattgtggc
gtggatgacctggatgcactcaccttcgccaactatatctgtaatgagcagggcttcgat
cccatcaccttcggcgccaccatggcggcagccatggagctgtacgagatgggagtgatc
accgatgaggataccggtggcgtgaagctgaacttcggctccgctgaggcactgaccacc
atggcagaactggtgggcaagggcgaaggctttggcaagatcctgggtctcggctccaag
cggctatgtgaaaaatacggtcatcctgagctctccatgagcgtcaagggacaggagttc
ccggcctacgatccgcgcggcatccagggtatgggtctcacctatgccaccagtaaccgg
ggcgcctgtcacctgcgcagctacaccgtggcgtcggagattctgggcattccggagaag
accgatccactggtgacggaaggcaaggcgggtctggtcaaggcgttccaggatgccacc
gcggcggtggactccagcggactctgtgtgttcaccacctttgcctggaccctggaggat
ttctatccccagatcgatgccgcctgtgagggtgagtggaccctggagcggctggccgag
accggtgaacgtatctggaatctggagcggcagttcaacatggccgccggctttaccgcc
aaggatgacacgctgccgaaacggctgctgacggaaccggccaccaccggcccggccgcc
ggtaaggtgagtggtctggccaagatgttacccgagtattacgaactgcgcggctggagc
aaggaaggggtgccgacaccggacaccctgcgtggtctcgggctctcgtaa

DBGET integrated database retrieval system