KEGG   Sedimenticola thiotaurini: AAY24_13195Help
Entry
AAY24_13195       CDS       T03943                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
seds  Sedimenticola thiotaurini
Brite
KEGG Orthology (KO) [BR:seds00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAY24_13195
Enzymes [BR:seds01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AAY24_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 FAD_oxidored DAO NAD_binding_8 Thi4 AlaDh_PNT_C Lycopene_cycl GMC_oxred_N FAD_binding_3 K_oxygenase Glutaredoxin Thioredoxin_4 NAD_binding_7 3HCDH_N Thioredoxin_9 HlyD DSBA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AKH21155
UniProt: A0A0F7K1W0
LinkDB All DBs
Position
2872922..2874499
Genome map
AA seq 525 aa AA seqDB search
MITPEIKQALSGYFANMQKPVTLVLQTGDHPKRGEQAGFLADISGISDNVNFEERDAGLR
SPMSFSLEVDGQPTGIVFSGIPGGHEFNSLILAILHASGSDMKLDDSIANLIKQVRKPLQ
FEVFISLSCHNCPDVVQALNQFALLNPDISSEMLDGGLFPEIIEERDIQGVPTVYLNGEL
FANGKVDAAQLLDKLIEHEPEITQAVDQPALPLQDVTVIGGGPAGVAAAIYSARKGLKVT
LIAERLGGQVKDTMGIENLISVPKTTGPELAGALQTHLNDYDITVKEHLRVTGVEQGNVK
KVTLTSGEVISTRTLIVATGARWRELGVPGEKENIGNGVAYCPHCDGPFFKGRDVAVIGG
GNSGIEAALDLAGIVHSVTVFEFLPQLKADQVLIDQAIARDNITIISNAATRQILAEDGK
VVGVEYEDRETGEVKQEELAGVFVQIGLVPNSQVVADLVETKPWGEIVINEKCETSAPGI
YACGDVTTVPYKQIVIAMGEGAKASLAAFEYLLTHNVETAESAAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatcacccccgaaataaaacaggccctcagcggatacttcgccaatatgcagaaaccg
gtcaccctggtgctgcagaccggcgaccacccaaagcgtggcgaacaggccggtttcctg
gccgacataagcggcatctctgacaacgtcaatttcgaggagcgtgatgccggactgcgt
agcccaatgagtttttcgctggaggttgatggccaaccgaccggcatagtcttctccggt
attcccggtggccacgaattcaactccctgatccttgccatcctgcacgcctccggtagc
gatatgaagctggatgacagtatcgccaacctgatcaagcaggtacgcaagcctttgcag
ttcgaggtgttcatcagtctcagctgccacaactgcccggacgtggtgcaggcacttaac
cagttcgccctgctgaatccggacatctcctcggagatgcttgacggcggactgtttccc
gaaattatcgaagagcgggatattcagggcgttcccacggtatacctgaacggggagttg
ttcgccaacggtaaggtggatgcggcgcaactgctcgacaagttgatcgagcatgaaccg
gagatcacccaggccgtggaccaaccggcacttccactgcaggatgtcaccgtgatcggt
ggcggaccggccggtgtggctgctgccatctacagtgcacgtaaaggtttaaaagtgacc
ctgatcgcagagcgtcttggtggtcaggtgaaggacacgatgggtattgagaatctgatc
tcggtacccaaaacgaccggcccggagctggccggtgccctgcagacccacctcaatgac
tacgacatcactgtcaaggagcacttgcgggtgaccggcgttgagcagggtaatgtaaaa
aaggtgaccctcaccagcggtgaggtgatctcgacccgcactctgatcgtcgcaaccggt
gcgcgctggcgggaactgggtgttcccggcgagaaggagaatattggaaacggagtggcc
tactgcccccactgtgacggccccttcttcaaaggcagggacgtggcggtgatcggtggt
ggtaactctggtatcgaagcggcgttggatctggccggtattgtccactcggtgacggtg
ttcgaattcctgccgcaactcaaggccgaccaggtattgatcgaccaggcgatcgcccgg
gacaacatcaccattatcagcaatgctgccaccaggcagattctggctgaagatggaaaa
gtggtcggcgttgaatatgaggaccgggaaaccggcgaagtgaaacaggaagagctggcc
ggcgtgtttgtgcagattggtctggtccccaacagccaggtggttgccgacctggtcgag
accaagccctggggtgagatcgtgatcaatgaaaagtgtgaaacctctgcgcccggcatc
tacgcctgtggtgacgtgaccacggtgccctacaagcagatcgtgattgccatgggcgaa
ggggccaaggcgtcactggcggcgttcgagtacctgctgacccacaacgtggaaacggct
gaaagtgccgccgcctaa

DBGET integrated database retrieval system