KEGG   Sedimenticola thiotaurini: AAY24_15555Help
Entry
AAY24_15555       CDS       T03943                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seds01100  Metabolic pathways
seds01110  Biosynthesis of secondary metabolites
seds01130  Biosynthesis of antibiotics
seds01230  Biosynthesis of amino acids
seds02024  Quorum sensing
Module
seds_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAY24_15555
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAY24_15555
Enzymes [BR:seds01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AAY24_15555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AKH21534
UniProt: A0A0F7K1V4
LinkDB All DBs
Position
complement(3375576..3376640)
Genome map
AA seq 354 aa AA seqDB search
MRHKTDDLRIETIKELVAPADLLAELPVTDAVADTVYQARRAIHRILHDEDDRVLAIVGP
CSVHDPAAARDYAARLNKLREELADDLLIVMRVYFEKPRTTVGWKGLINDPDLDGTFHIN
KGLRMARQLLLDVNSLGLPAGTEFLDLISPQYIADLVSWGAIGARTTESQGHRELASGLS
CPVGFKNGTNGTLRIALDAIRAASQPHCFLSVTKERHSAIFTTRGNEDCHVILRGGSRPN
YDTESINIASAEMEQCGFKPRLMIDFSHANSRKQHQKQIDVGHDVAGQIARGDQRINGVM
IESFLEAGRQDWRADEELVYGQSITDACISWSDTEPLLRTLAEAVRQRRTRRNG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacaaaaccgacgacctgcgtatcgaaacgatcaaggagctggtggctccggcc
gacctgctggctgaattacccgtgaccgacgcggtggccgacacggtttaccaggcgcgc
cgggccattcaccgcatcctgcatgacgaggatgatcgggtactggccatcgtcggcccc
tgttcggtgcatgacccggccgcggcgcgggactacgccgcccggctgaacaaactgcgt
gaagagctggccgacgatctgctgatcgtgatgcgggtctatttcgaaaagccccgcact
acggtgggctggaaagggctgatcaacgatcccgatctggacggcaccttccatatcaac
aaagggctgcgcatggcccgccagctgctcctggatgtcaacagtctgggcttgcccgcc
ggcactgaatttctggatctgatcagcccccagtacattgccgacctggtgagctggggc
gccatcggcgcgcgcaccaccgagagccagggacaccgggaactggcctccggtctctcc
tgcccggtgggcttcaagaacggcaccaacggcaccctgcgcatcgccctggacgccatc
cgcgccgcctcccagccgcactgtttcctgtccgtgaccaaggagcgtcactcggccatc
ttcaccacccggggcaacgaggattgccacgtcatcctgcggggtggcagccgtcccaat
tacgacaccgagagtatcaacatcgcttccgcagagatggagcagtgtggcttcaaaccg
cgcctgatgatcgatttcagccacgccaactcgcgcaagcagcaccagaaacagatcgac
gtgggccacgacgtggccggccagatcgcccggggcgaccagcgtatcaacggcgtcatg
atcgagagcttcctggaagcgggacgtcaggattggcgcgcggacgaggagctggtctat
ggccagagcatcaccgatgcctgcatcagctggagcgacaccgagccgttgctgcgcacc
ctggccgaagcggtccggcagcgccgcacacgccgcaacggctga

DBGET integrated database retrieval system