KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0836Help
Entry
SNSL254_A0836     CDS       T00739                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00010  Glycolysis / Gluconeogenesis
see00260  Glycine, serine and threonine metabolism
see00680  Methane metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
see01200  Carbon metabolism
see01230  Biosynthesis of amino acids
Module
see_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
see_M00002  Glycolysis, core module involving three-carbon compounds
see_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:see00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNSL254_A0836 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SNSL254_A0836 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNSL254_A0836 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:see04131]
    SNSL254_A0836 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:see04147]
    SNSL254_A0836 (gpmA)
Enzymes [BR:see01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SNSL254_A0836 (gpmA)
Membrane trafficking [BR:see04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SNSL254_A0836 (gpmA)
Exosome [BR:see04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SNSL254_A0836 (gpmA)
  Exosomal proteins of melanoma cells
   SNSL254_A0836 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACF64318
UniProt: B4SZH5
LinkDB All DBs
Position
complement(840714..841466)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctaccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggcaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system