KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1823Help
Entry
SNSL254_A1823     CDS       T00739                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00061  Fatty acid biosynthesis
see00780  Biotin metabolism
see01100  Metabolic pathways
see01130  Biosynthesis of antibiotics
see01212  Fatty acid metabolism
Module
see_M00083  Fatty acid biosynthesis, elongation
see_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:see00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SNSL254_A1823 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SNSL254_A1823 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SNSL254_A1823 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:see01004]
    SNSL254_A1823 (fabI)
Enzymes [BR:see01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SNSL254_A1823 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SNSL254_A1823 (fabI)
Lipid biosynthesis proteins [BR:see01004]
 Fatty acid synthase
  Component type
   SNSL254_A1823 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACF62773
UniProt: A0A0H3BRD9
LinkDB All DBs
Position
1788491..1789279
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LPCDVAEDASIDAMFAELGNVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRTMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtcactggcgtggccagtaaactgtccatc
gcctacggtatcgcacaggcgatgcaccgcgaaggagctgaactggcgttcacctaccag
aacgacaaactgaaaggccgtgtagaagaatttgctgcccagctgggttccagcatcgtt
ttaccgtgtgatgtcgctgaagatgccagcattgacgctatgtttgcagagctgggtaac
gtttggccgaaatttgacggttttgtacactcgatcggtttcgcgcctggcgatcagctg
gacggcgattatgttaatgcggttacccgcgaaggctttaaaatcgctcacgatattagc
tcttacagctttgttgccatggcgaaagcctgccgcaccatgctgaatccgggttctgcg
ctgttgaccttgtcttatctgggagcggagcgcgccatcccgaactacaatgtcatgggt
ctggcgaaagcctctctggaagccaacgtgcgttatatggcaaacgctatgggaccggaa
ggggttcgcgtcaacgccatctctgcgggtccaatccgcacgctggcggcgtccggtatt
aaagacttccgtaaaatgctggcgcattgtgaagccgttacgccaattcgtcgcaccgtg
accattgaagatgtgggtaactcagcggcgtttctgtgttccgatctctcggcaggcatt
tctggcgaagtcgtccatgttgacggcgggttcagcattgcggcaatgaatgaactggaa
ctgaagtaa

DBGET integrated database retrieval system