KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A2487Help
Entry
SNSL254_A2487     CDS       T00739                                 

Definition
(GenBank) inner membrane protein YfbW
  KO
K12962  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:see00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SNSL254_A2487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:see01005]
    SNSL254_A2487
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:see02000]
    SNSL254_A2487
Lipopolysaccharide biosynthesis proteins [BR:see01005]
 Unusual sugar
  SNSL254_A2487
Transporters [BR:see02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SNSL254_A2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Multi_Drug_Res TMEM234 DUF202 DUF981
Motif
Other DBs
NCBI-ProteinID: ACF62499
UniProt: B4SYX4
LinkDB All DBs
Position
2412372..2412707
Genome map
AA seq 111 aa AA seqDB search
MIGVILVLASLLSVGGQLCQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQT
LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgtcattctggtgcttgccagtctgctcagcgttggcggtcagctctgccag
aagcaagcgacacggccattgacggcgggcggacgccgccgtcacctgatgctgtggctg
ggcctggcgctgatatgcatgggcgcagcgatggtgctgtggctgctggtgctacaaacc
ctgccggtgggaattgcttacccgatgttgagtctgaattttgtctgggtcacgctggcg
gcatggaaaatctggcatgaacaggttccgccccgccactggttgggcgtcgcattgatt
atcagcggcattatcattctggggagtgcggcataa

DBGET integrated database retrieval system