KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A3859Help
Entry
SNSL254_A3859     CDS       T00739                                 

Definition
(GenBank) probable low-affinity inorganic phosphate transporter 2
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:see02000]
    SNSL254_A3859
Transporters [BR:see02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SNSL254_A3859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ACF63472
UniProt: A0A0H3BQ99
LinkDB All DBs
Position
3733051..3734547
Genome map
AA seq 498 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSAHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNAMMTGTSVVDALNIPKVINIFGSLIISPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNASSYEITRTRDAINNVETYFEQRPDLLKAVTGVDQLIPSPEPGATE
PTEFHCHPANTINALNRAKGMLANVESYDKLSVEQRSQLRRIMLCISDTTDKVVKLPGVS
SDDQRLLKKLKTDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTYA
QGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFTL
PAAIILSGVLYWLSLKII
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgtttgctggcctggatttacataccgggcttttattattgcttgctctg
gcttttgtgctgttctacgaagcgattaacggcttccatgacacagccaatgcagtcgca
accgtgatttacacccgtgcgatgcgttcgcagctggcggttgtcatggcggcggtgttt
aacttttttggcgttttgctggggggtctcagcgtggcgtatgccattgtgcatatgcta
ccgacggatctcctgctcaacatgggttccgcgcacggcctcgctatggtcttttccatg
ttgctggcggcgattatctggaacctcggtacctggtatttcgggttgccggcgtccagt
tcccacacgctgattggcgccattatcggcatcggtttaaccaatgcgatgatgaccggc
acgtcagtggtggatgcgcttaacatcccgaaagttatcaatattttcggttcactcatt
atctcccctattgtcggtctggtattcgccggcggtctgattttcttgctgcgccgctac
tggagcggtactaagaaacgcgcccgtatccacctgacgccagccgaacgtgaaaagaaa
gacggcaagaaaaagccgccgttctggacgcgtatcgcgctgatcctctccgctatcggc
gtggcgttttcgcatggcgcgaacgatggtcagaaaggcattggcctggtcatgctggtg
ctgattggcgtcgcgcctgcgggtttcgtggtcaatatgaatgcctccagctacgaaatc
acccgtacgcgcgatgctatcaacaatgtcgaaacgtactttgagcagcgtcctgacctg
ctgaaagccgtcaccggcgttgaccaactgattccctctccggaaccgggcgcgactgaa
ccgactgaattccactgccatccggctaacaccattaacgcgcttaaccgtgcgaaaggg
atgctggcaaacgtggaaagctacgacaagttaagcgttgaacagcgtagtcagttgcgt
cgcattatgctgtgcatttccgacacgaccgataaagtcgtgaaattgcctggcgtaagc
agcgatgaccagcgcctgctgaaaaagctgaagaccgatatgttaagcaccattgagtat
gcgccggtgtggatcattatggcagtggcgttggcgctgggtattggtacgatgatcggc
tggcgtcgcgtggcgaccactatcggcgagaaaattggtaaaaaaggcatgacgtatgcg
cagggaatgtcggcgcagatgacggcggcagtctctatcggtcttgccagctacaccggt
atgccagtttctaccactcacgtactctcctcttcagtggcgggaaccatggtcgttgat
ggcggcgggttgcagcgtaaaaccgtgaccagcattctgatggcctgggtatttacgtta
ccggcggcgattattctttccggcgtgctgtactggctttccctgaagattatttaa

DBGET integrated database retrieval system